From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA2383 [new locus tag: SA_RS13645 ]
  • pan locus tag?: SAUPAN006285000
  • symbol: SA2383
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA2383 [new locus tag: SA_RS13645 ]
  • symbol: SA2383
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2671339..2672001
  • length: 663
  • essential: no DEG

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    TTGAATACAATAGAATCACAGTTTGATAAGGTTGCAGAAGATTACGATTTCGTGAATGAG
    CTTTTGAATGATTATTCATTCTTTGTGTCTAATATGTCTCCAAAGAAAGGCAGAGCATTA
    GATATCGGATGTGGCTCGGGTTTGTTAGTGGAGAAATTAGCAAGTTATTATGATGAAGTG
    GTAGGGATTGATATTTCTAATCAAATGCTCGATCTTGCCAAATCTAAACGTCAACTAACA
    AATACGGTCTATCTGAATATGAATGCAGAACAACTTAATTTTAATGAGAAGTTTGATTTT
    ATTGTAAGCCGAACAACCTTTCATCATTTGGATGATATAGCCAGCGTAATACAGCAAATG
    AAGGAACTGTTGAATGAGGAAGGAAGAATAGTTATTCTTGATAATGTATCTGAAGTCGAG
    ACACCGCCTACCTATGTTTATAAATTAGGGGCAATCCAAGAGTTTTTACCGCATTGTTTC
    AAATTTGGAATAAAAAATGCGATTAGAATTTATAATCACAACACATCTAAATCATGGCTT
    GAGCATTTAGCTTCAGATAAGTACCTATCTGAACAAAATTATTACGATTTATATGAAAAG
    TTGTTGCCTGGATGCCAATTCCATAAAATGGGTTGGGCAATGGGGGTTGTCTGGACAAAA
    TAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    663

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA2383 [new locus tag: SA_RS13645 ]
  • symbol: SA2383
  • description: hypothetical protein
  • length: 220
  • theoretical pI: 4.95042
  • theoretical MW: 25439.8
  • GRAVY: -0.292273

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersBiotinmalonyl-acyl carrier protein O-methyltransferase BioC (TIGR02072; EC 2.1.1.-; HMM-score: 67.8)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersMenaquinone and ubiquinoneubiquinone/menaquinone biosynthesis methyltransferase (TIGR01934; EC 2.1.1.-; HMM-score: 62.2)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersMenaquinone and ubiquinone3-demethylubiquinone-9 3-O-methyltransferase (TIGR01983; EC 2.1.1.64; HMM-score: 61.6)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersGlutathione and analogsputative 4-mercaptohistidine N1-methyltranferase (TIGR04345; HMM-score: 50.8)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersChlorophyll and bacteriochlorphyllmagnesium protoporphyrin O-methyltransferase (TIGR02021; EC 2.1.1.11; HMM-score: 40.2)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersMenaquinone and ubiquinonedemethylmenaquinone methyltransferase (TIGR02752; EC 2.1.1.163; HMM-score: 37)
    Cellular processesCellular processesToxin production and resistancetellurite resistance protein TehB (TIGR00477; HMM-score: 29.1)
    Unknown functionEnzymes of unknown specificitytRNA (mo5U34)-methyltransferase (TIGR00452; EC 2.1.1.-; HMM-score: 28.8)
    Genetic information processingProtein fateProtein modification and repairprotein-(glutamine-N5) methyltransferase, release factor-specific (TIGR03534; EC 2.1.1.-; HMM-score: 26.3)
    MetabolismAmino acid biosynthesisAspartate familymethionine biosynthesis protein MetW (TIGR02081; HMM-score: 25.5)
    Genetic information processingProtein synthesistRNA and rRNA base modification16S rRNA (guanine(527)-N(7))-methyltransferase RsmG (TIGR00138; EC 2.1.1.170; HMM-score: 23.9)
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal protein L11 methyltransferase (TIGR00406; EC 2.1.1.-; HMM-score: 23.6)
    Unknown functionEnzymes of unknown specificityputative methylase (TIGR00537; HMM-score: 22.9)
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationprotein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific (TIGR03533; EC 2.1.1.-; HMM-score: 21.3)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalaminprecorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit (TIGR02469; EC 2.1.1.132; HMM-score: 20.9)
    Genetic information processingTranscriptionRNA processing3' terminal RNA ribose 2'-O-methyltransferase Hen1 (TIGR04074; EC 2.1.1.-; HMM-score: 19)
    Genetic information processingProtein synthesistRNA and rRNA base modification3' terminal RNA ribose 2'-O-methyltransferase Hen1 (TIGR04074; EC 2.1.1.-; HMM-score: 19)
    Genetic information processingProtein fateProtein modification and repairmethyltransferase, HemK family (TIGR00536; HMM-score: 18.8)
    2-ketoarginine methyltransferase (TIGR04543; EC 2.1.1.243; HMM-score: 18.1)
    methyltransferase, Rta_06860 family (TIGR04290; EC 2.1.1.-; HMM-score: 17.9)
    Genetic information processingProtein synthesistRNA and rRNA base modificationribosomal RNA small subunit methyltransferase A (TIGR00755; EC 2.1.1.182; HMM-score: 17.8)
    Genetic information processingProtein synthesistRNA and rRNA base modificationtRNA (guanine-N(7)-)-methyltransferase (TIGR00091; EC 2.1.1.33; HMM-score: 17.5)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesputative sugar O-methyltransferase (TIGR04371; EC 2.1.1.-; HMM-score: 16.4)
    Genetic information processingProtein fateProtein modification and repairprotein-L-isoaspartate O-methyltransferase (TIGR00080; EC 2.1.1.77; HMM-score: 13)
    Genetic information processingProtein synthesistRNA and rRNA base modification23S rRNA (uracil-5-)-methyltransferase RumA (TIGR00479; EC 2.1.1.-; HMM-score: 11.4)
  • TheSEED:  
    Mobile element protein 
  • PFAM:
    NADP_Rossmann (CL0063) Methyltransf_11; Methyltransferase domain (PF08241; HMM-score: 78.2)
    Methyltransf_23; Methyltransferase domain (PF13489; HMM-score: 72.8)
    Methyltransf_25; Methyltransferase domain (PF13649; HMM-score: 69.9)
    Methyltransf_31; Methyltransferase domain (PF13847; HMM-score: 67.8)
    Methyltransf_12; Methyltransferase domain (PF08242; HMM-score: 66.9)
    Ubie_methyltran; ubiE/COQ5 methyltransferase family (PF01209; HMM-score: 44.2)
    MTS; Methyltransferase small domain (PF05175; HMM-score: 39)
    TehB; Tellurite resistance protein TehB (PF03848; HMM-score: 37)
    NodS; Nodulation protein S (NodS) (PF05401; HMM-score: 36.1)
    CMAS; Mycolic acid cyclopropane synthetase (PF02353; HMM-score: 32.1)
    Methyltransf_9; Protein of unknown function (DUF1698) (PF08003; HMM-score: 31.5)
    TPMT; Thiopurine S-methyltransferase (TPMT) (PF05724; HMM-score: 29.9)
    PrmA; Ribosomal protein L11 methyltransferase (PrmA) (PF06325; HMM-score: 28.2)
    GidB; rRNA small subunit methyltransferase G (PF02527; HMM-score: 24.7)
    MetW; Methionine biosynthesis protein MetW (PF07021; HMM-score: 22.2)
    Methyltransf_32; Methyltransferase domain (PF13679; HMM-score: 21.7)
    Methyltransf_PK; AdoMet dependent proline di-methyltransferase (PF05891; HMM-score: 21.3)
    DREV; DREV methyltransferase (PF05219; HMM-score: 21.2)
    CheR; CheR methyltransferase, SAM binding domain (PF01739; HMM-score: 16.6)
    AdoMet_MTase; Predicted AdoMet-dependent methyltransferase (PF07757; HMM-score: 16.6)
    Methyltransf_4; Putative methyltransferase (PF02390; HMM-score: 16.4)
    RrnaAD; Ribosomal RNA adenine dimethylase (PF00398; HMM-score: 14.7)
    PCMT; Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) (PF01135; HMM-score: 14.3)
    Methyltransf_18; Methyltransferase domain (PF12847; HMM-score: 13.8)
    no clan definedDNA_pol3_a_NI; DNA polymerase III polC-type N-terminus I (PF14480; HMM-score: 13.6)
    NADP_Rossmann (CL0063) Methyltransf_15; RNA cap guanine-N2 methyltransferase (PF09445; HMM-score: 13.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.13
    • Ymax_pos: 40
    • Cmax: 0.13
    • Cmax_pos: 40
    • Smax: 0.196
    • Smax_pos: 39
    • Smean: 0.077
    • D: 0.11
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNTIESQFDKVAEDYDFVNELLNDYSFFVSNMSPKKGRALDIGCGSGLLVEKLASYYDEVVGIDISNQMLDLAKSKRQLTNTVYLNMNAEQLNFNEKFDFIVSRTTFHHLDDIASVIQQMKELLNEEGRIVILDNVSEVETPPTYVYKLGAIQEFLPHCFKFGIKNAIRIYNHNTSKSWLEHLASDKYLSEQNYYDLYEKLLPGCQFHKMGWAMGVVWTK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]