From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA2422 [new locus tag: SA_RS13890 ]
  • pan locus tag?: SAUPAN006356000
  • symbol: SA2422
  • pan gene symbol?: estA
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA2422 [new locus tag: SA_RS13890 ]
  • symbol: SA2422
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2717418..2718179
  • length: 762
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGGCTTATATTTCATTAAACTATCATTCACCAACAATTGGTATGCATCAAAATTTGACA
    GTCATTTTACCGGAAGATCAAAGCTTCTTTAATAACGATATAACTGCTAAACCATTAAAA
    ACTTTAATGTTGTTACATGGATTATCAAGTGATGAAACGACATATATGAGATATACAAGC
    ATAGAAAGGTATGCGAATGAACACAAATTAGCTGTGATTATGCCCAATGTGGATCATAGC
    GCATATGCTAACATGGCATATGGTCATAGCTATTATGATTATATTTTGGAAGTATATGAT
    TATGTTCATCAAATATTTCCACTTTCCAAAAAGCGTGATGACAATTTTATAGCAGGTCAC
    TCTATGGGAGGATATGGCACAATTAAATTTGCATTAACACAAGGGGATAAATTTGCCAAA
    GCTGTACCATTATCTGCTGTGTTTGAAGCGCAAAATTTAATGGATCTAGAGTGGAATGAT
    TTTTCAAAAGAGGCCATAATTGGCAATCTTTCAAGTGTTAAAGGAACTGAACATGATCCG
    TATTATTTGCTAGACAAAGCTGTAGCTGAAGATAAACAAATTCCAAAATTGCTCATTATG
    TGTGGTAAACAAGACTTTTTATATCAAGACAACTTAGATTTTATCGATTATTTATCACGT
    AAAAATGTTCCTTATCAATTTGAAGATGGACCAGGAGATCATGATTATGCATATTGGGAC
    CAAGCGATTAAGCGTGCTATAACATGGATGGTGAATGATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    762

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA2422 [new locus tag: SA_RS13890 ]
  • symbol: SA2422
  • description: hypothetical protein
  • length: 253
  • theoretical pI: 4.95152
  • theoretical MW: 29121.7
  • GRAVY: -0.367194

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesDetoxificationS-formylglutathione hydrolase (TIGR02821; EC 3.1.2.12; HMM-score: 45.2)
    MetabolismFatty acid and phospholipid metabolismDegradationesterase, PHB depolymerase family (TIGR01840; EC 3.1.1.-; HMM-score: 19.3)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersMenaquinone and ubiquinone2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (TIGR03695; EC 4.2.99.20; HMM-score: 15.9)
    MetabolismAmino acid biosynthesisAspartate familyhomoserine O-acetyltransferase (TIGR01392; EC 2.3.1.31; HMM-score: 13.8)
  • TheSEED:  
    Tributyrin esterase 
  • PFAM:
    AB_hydrolase (CL0028) Esterase; Putative esterase (PF00756; HMM-score: 56.5)
    Peptidase_S9; Prolyl oligopeptidase family (PF00326; HMM-score: 29.4)
    Hydrolase_4; Serine aminopeptidase, S33 (PF12146; HMM-score: 28.6)
    Abhydrolase_3; alpha/beta hydrolase fold (PF07859; HMM-score: 17.4)
    Abhydrolase_5; Alpha/beta hydrolase family (PF12695; HMM-score: 13.9)
    Abhydrolase_1; alpha/beta hydrolase fold (PF00561; HMM-score: 13.8)
    Abhydrolase_6; Alpha/beta hydrolase family (PF12697; HMM-score: 13.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.129
    • Ymax_pos: 25
    • Cmax: 0.139
    • Cmax_pos: 37
    • Smax: 0.179
    • Smax_pos: 21
    • Smean: 0.143
    • D: 0.134
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MAYISLNYHSPTIGMHQNLTVILPEDQSFFNNDITAKPLKTLMLLHGLSSDETTYMRYTSIERYANEHKLAVIMPNVDHSAYANMAYGHSYYDYILEVYDYVHQIFPLSKKRDDNFIAGHSMGGYGTIKFALTQGDKFAKAVPLSAVFEAQNLMDLEWNDFSKEAIIGNLSSVKGTEHDPYYLLDKAVAEDKQIPKLLIMCGKQDFLYQDNLDFIDYLSRKNVPYQFEDGPGDHDYAYWDQAIKRAITWMVND

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]