From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA2484 [new locus tag: SA_RS14210 ]
  • pan locus tag?: SAUPAN006449000
  • symbol: SA2484
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA2484 [new locus tag: SA_RS14210 ]
  • symbol: SA2484
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2795305..2795643
  • length: 339
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGTCAGTGTCAGATCAGATTATGAAAGGTCTCTTAGATGGGGCGATATTAGGTCTCATT
    GCCCAAGGCGAAACGTATGGATATGAAATTATGACGAAACTTAAGAATCAAGAGTTTCCA
    GAGATAAGTGAGGGTAGTATTTATCCAGTTTTAATGCGTTTAAACAAAAAAGGATACGTT
    GATACGACAATAAAAAAATCTAGTAATGGCGGCCCGAGGCGGAAATACTATACGATTACC
    GATTCAGGTTTAAAGGAACTAAAAGTATTTAAATCAAAATGGCAAGCTTTGAATAAAGGG
    ATGATTAACTTGTTTGGAGGGGAAAACGATGTTAACTAA
    60
    120
    180
    240
    300
    339

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA2484 [new locus tag: SA_RS14210 ]
  • symbol: SA2484
  • description: hypothetical protein
  • length: 112
  • theoretical pI: 9.77653
  • theoretical MW: 12514.4
  • GRAVY: -0.423214

Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions transcriptional regulator, Acidobacterial, PadR-family (TIGR03433; HMM-score: 60.9)
    and 2 more
    Signal transduction Regulatory functions DNA interactions poly-beta-hydroxybutyrate-responsive repressor (TIGR02719; HMM-score: 30.7)
    Signal transduction Regulatory functions DNA interactions phenylacetic acid degradation operon negative regulatory protein PaaX (TIGR02277; HMM-score: 12.1)
  • TheSEED  :
    • Transcriptional regulator, PadR family
  • PFAM:
    HTH (CL0123) PadR; Transcriptional regulator PadR-like family (PF03551; HMM-score: 82.2)
    and 5 more
    HTH_34; Winged helix DNA-binding domain (PF13601; HMM-score: 22.8)
    TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 16.2)
    Replic_Relax; Replication-relaxation (PF13814; HMM-score: 14.5)
    FUR; Ferric uptake regulator family (PF01475; HMM-score: 12.1)
    LexA_DNA_bind; LexA DNA binding domain (PF01726; HMM-score: 11.7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.036252
    • TAT(Tat/SPI): 0.009143
    • LIPO(Sec/SPII): 0.008957
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MSVSDQIMKGLLDGAILGLIAQGETYGYEIMTKLKNQEFPEISEGSIYPVLMRLNKKGYVDTTIKKSSNGGPRRKYYTITDSGLKELKVFKSKWQALNKGMINLFGGENDVN

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]