From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0066 [new locus tag: SACOL_RS00340 ]
  • pan locus tag?: SAUPAN000751000
  • symbol: SACOL0066
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL0066 [new locus tag: SACOL_RS00340 ]
  • symbol: SACOL0066
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 76215..76316
  • length: 102
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    TTGAGTACACGTGGTTTGAATATCTGGCAAGAAATGGAAATTGGTAATGTCAGTCATAAA
    GTCGCTAAACGTGCTCAAATACCATTAATTATTTTTAAATAA
    60
    102

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL0066 [new locus tag: SACOL_RS00340 ]
  • symbol: SACOL0066
  • description: hypothetical protein
  • length: 33
  • theoretical pI: 11.0585
  • theoretical MW: 3809.53
  • GRAVY: -0.0545455

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    Conserved domain protein 
  • PFAM:
    HUP (CL0039) Usp; Universal stress protein family (PF00582; HMM-score: 15.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.099
    • Ymax_pos: 25
    • Cmax: 0.11
    • Cmax_pos: 25
    • Smax: 0.109
    • Smax_pos: 16
    • Smean: 0.08
    • D: 0.092
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MSTRGLNIWQEMEIGNVSHKVAKRAQIPLIIFK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]