Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0137 [new locus tag: SACOL_RS00695 ]
- pan locus tag?: SAUPAN000975000
- symbol: cap5B
- pan gene symbol?: capB
- synonym:
- product: capsular polysaccharide biosynthesis protein Cap5B
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0137 [new locus tag: SACOL_RS00695 ]
- symbol: cap5B
- product: capsular polysaccharide biosynthesis protein Cap5B
- replicon: chromosome
- strand: +
- coordinates: 154089..154775
- length: 687
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236370 NCBI
- RefSeq: YP_185037 NCBI
- BioCyc: see SACOL_RS00695
- MicrobesOnline: 911614 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661ATGTCAAAAAAGGAAAATACGACAACAACACTATTTGTATATGAAAAACCAAAATCAACA
ATTAGTGAAAAGTTTCGAGGTATACGTTCAAACATCATGTTTTCAAAAGCAAATGGTGAA
GTAAAGCGCTTATTGGTTACTTCTGAAAAGCCTGGTGCAGGTAAAAGTACAGTTGTATCG
AATGTAGCGATTACTTATGCACAAGCAGGCTATAAGACATTAGTTATTGATGGCGATATG
CGTAAGCCAACACAAAACTATATTTTTAATGAGCAAAATAATAATGGACTATCAAGCTTA
ATCATTGGTCGAACGACTATGTCAGAAGCAATTACGTCGACAGAAATTGAAAATTTAGAT
TTGCTAACAGCTGGCCCTGTACCTCCAAATCCATCTGAGTTAATTGGGTCTGAAAGGTTC
AAAGAATTAGTTGATCTGTTTAATAAACGTTACGACATTATTATTGTCGATACACCGCCA
GTTAATACTGTGACTGATGCACAACTATATGCGCGTGCTATTAAAGATAGTCTGTTAGTA
ATTGATAGTGAAAAAAATGATAAAAATGAAGTTAAAAAAGCAAAAGCACTTATGGAAAAA
GCAGGCAGTAACATTCTAGGTGTCATTTTGAACAAGACAAAGGTCGATAAATCTTCTAGT
TATTATCACTATTATGGAGATGAATAA60
120
180
240
300
360
420
480
540
600
660
687
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0137 [new locus tag: SACOL_RS00695 ]
- symbol: Cap5B
- description: capsular polysaccharide biosynthesis protein Cap5B
- length: 228
- theoretical pI: 9.3191
- theoretical MW: 25284.6
- GRAVY: -0.421053
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Carbohydrates, organic alcohols, and acids capsular exopolysaccharide family (TIGR01007; HMM-score: 312.3)and 19 morechain length determinant protein tyrosine kinase EpsG (TIGR03029; HMM-score: 149.2)Transport and binding proteins Carbohydrates, organic alcohols, and acids exopolysaccharide transport protein family (TIGR01005; HMM-score: 123.9)exopolysaccharide/PEP-CTERM locus tyrosine autokinase (TIGR03018; EC 2.7.10.2; HMM-score: 121.2)cell division ATPase MinD (TIGR01969; HMM-score: 62)Cellular processes Cell division septum site-determining protein MinD (TIGR01968; HMM-score: 42.3)Hypothetical proteins Conserved transport-energizing ATPase, TRC40/GET3/ArsA family (TIGR00345; EC 3.6.1.-; HMM-score: 23.7)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides cellulose synthase operon protein YhjQ (TIGR03371; HMM-score: 20.8)Central intermediary metabolism Nitrogen fixation nitrogenase iron protein (TIGR01287; EC 1.18.6.1; HMM-score: 20.5)Mobile and extrachromosomal element functions Plasmid functions plasmid partitioning protein RepA (TIGR03453; HMM-score: 20.1)helicase/secretion neighborhood CpaE-like protein (TIGR03815; HMM-score: 17)Transport and binding proteins Amino acids, peptides and amines LAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 16.4)Regulatory functions Protein interactions LAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 16.4)signal recognition particle protein SRP54 (TIGR01425; HMM-score: 13.9)Central intermediary metabolism Sulfur metabolism adenylyl-sulfate kinase (TIGR00455; EC 2.7.1.25; HMM-score: 13.8)Biosynthesis of cofactors, prosthetic groups, and carriers Chlorophyll and bacteriochlorphyll light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein (TIGR01281; EC 1.3.7.7; HMM-score: 13.4)Mobile and extrachromosomal element functions Prophage functions phage replicative helicase, DnaB family (TIGR03600; HMM-score: 12.9)arsenical pump-driving ATPase (TIGR04291; EC 3.6.1.-; HMM-score: 12.9)Protein fate Protein and peptide secretion and trafficking signal recognition particle-docking protein FtsY (TIGR00064; HMM-score: 12.3)Energy metabolism Photosynthesis chlorophyllide reductase iron protein subunit X (TIGR02016; HMM-score: 12)
- TheSEED :
- Capsular polysaccharide synthesis enzyme CapB
- Tyrosine-protein kinase EpsD (EC 2.7.10.2)
Cell Wall and Capsule Capsular and extracellular polysacchrides Exopolysaccharide Biosynthesis Tyrosine-protein kinase EpsD (EC 2.7.10.2)and 1 more - PFAM: P-loop_NTPase (CL0023) AAA_31; AAA domain (PF13614; HMM-score: 59)and 14 moreParA; NUBPL iron-transfer P-loop NTPase (PF10609; HMM-score: 46.7)CbiA; CobQ/CobB/MinD/ParA nucleotide binding domain (PF01656; HMM-score: 42.2)MipZ; ATPase MipZ (PF09140; HMM-score: 37.9)ArsA_ATPase; Anion-transporting ATPase (PF02374; HMM-score: 22)AAA_26; AAA domain (PF13500; HMM-score: 20.7)Fer4_NifH; 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family (PF00142; HMM-score: 19.7)SRP54; SRP54-type protein, GTPase domain (PF00448; HMM-score: 19.5)ArgK; ArgK protein (PF03308; HMM-score: 18.8)CBP_BcsQ; Cellulose biosynthesis protein BcsQ (PF06564; HMM-score: 18.5)cobW; CobW/HypB/UreG, nucleotide-binding domain (PF02492; HMM-score: 16.5)Helicase_C; Helicase conserved C-terminal domain (PF00271; HMM-score: 15.4)no clan defined AFOR_N; Aldehyde ferredoxin oxidoreductase, N-terminal domain (PF02730; HMM-score: 13.6)P-loop_NTPase (CL0023) APS_kinase; Adenylylsulphate kinase (PF01583; HMM-score: 13)AAA_30; AAA domain (PF13604; HMM-score: 12.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.01
- Cytoplasmic Membrane Score: 9.99
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.021296
- TAT(Tat/SPI): 0.003623
- LIPO(Sec/SPII): 0.002909
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKSTVVSNVAITYAQAGYKTLVIDGDMRKPTQNYIFNEQNNNGLSSLIIGRTTMSEAITSTEIENLDLLTAGPVPPNPSELIGSERFKELVDLFNKRYDIIIVDTPPVNTVTDAQLYARAIKDSLLVIDSEKNDKNEVKKAKALMEKAGSNILGVILNKTKVDKSSSYYHYYGDE
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3]
- quantitative data / protein copy number per cell: 83 [4]
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: cap5A > cap5B > cap5C > cap5D > cap5E > cap5F > cap5G > cap5H > cap5I > cap5J > cap5K > cap5L > cap5M > cap5N > cap5O > cap5P
⊟Regulation[edit | edit source]
- regulators: CodY (repression) regulon, SigB* (activation) regulon
CodY (TF) important in Amino acid metabolism; RegPrecise transcription unit transferred from N315 data RegPrecise SigB* (sigma factor) controlling a large regulon involved in stress/starvation response and adaptation [7] [8] other strains
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: 44.13 h [9]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ Daniela Keinhörster, Shilpa Elizabeth George, Christopher Weidenmaier, Christiane Wolz
Function and regulation of Staphylococcus aureus wall teichoic acids and capsular polysaccharides.
Int J Med Microbiol: 2019, 309(6);151333
[PubMed:31362856] [WorldCat.org] [DOI] (I p) - ↑ S Sau, J Sun, C Y Lee
Molecular characterization and transcriptional analysis of type 8 capsule genes in Staphylococcus aureus.
J Bacteriol: 1997, 179(5);1614-21
[PubMed:9045821] [WorldCat.org] [DOI] (P p) - ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
J Bacteriol: 2004, 186(13);4085-99
[PubMed:15205410] [WorldCat.org] [DOI] (P p) - ↑ Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
The sigmaB regulon in Staphylococcus aureus and its regulation.
Int J Med Microbiol: 2006, 296(4-5);237-58
[PubMed:16644280] [WorldCat.org] [DOI] (P p) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]