From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0143 [new locus tag: SACOL_RS00725 ]
  • pan locus tag?: SAUPAN000982000
  • symbol: cap5H
  • pan gene symbol?: capH
  • synonym:
  • product: capsular polysaccharide biosynthesis protein Cap5H

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL0143 [new locus tag: SACOL_RS00725 ]
  • symbol: cap5H
  • product: capsular polysaccharide biosynthesis protein Cap5H
  • replicon: chromosome
  • strand: +
  • coordinates: 160656..161282
  • length: 627
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGAGGATAGCGATTGAAAAGATAATTGGTTTGCTGAAAAACCAGTCCTCTAAAGAATCG
    AATGTTAAGATTCATCGCTTGGCGTATATTACAAACTCAAAATTTGATGGCAATAACTAT
    ATAGATAGATGGTGTAAAATCAGGAATTCTCACATTGGTGAATACAGTTATATTGGATTT
    GGTAGTGATTTTAATAATGTAGAAGTAGGAAGATATTGTTCGATATCTTCGGATGTAAAA
    ATTGGGTTAGGAAAACATCCTACACACTTTTTTAGCTCATCACCGATTTTTTATTCTAAT
    AATAATCCATTTAACATAAAGCAAAAGTTTATAGACTTTAATGACCAACCAAGCCGTACA
    ACAATTAAAAATGATGTGTGGATTGGTGCAAATGTAATTATTATGGATGGTTTAACAATA
    AATACTGGTGCAGTCATAGCAGCCGGCTCAGTTGTTACTAAAAATGTAGGAGCATATGAG
    GTTGTTGGTGGTGTTCCTGCAAAAGTGATTAAGAAGCGATTTGACAATAAAACAATTGAA
    AAACTTTTGGAAAGCAAGTGGTGGGAGAAAACGCCTGACAAACTAAAAGGATTTTCGGTT
    GAATATTTAAATAAAAAGGATACTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    627

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL0143 [new locus tag: SACOL_RS00725 ]
  • symbol: Cap5H
  • description: capsular polysaccharide biosynthesis protein Cap5H
  • length: 208
  • theoretical pI: 10.0346
  • theoretical MW: 23476.7
  • GRAVY: -0.373558

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    phosphonate metabolim protein, transferase hexapeptide repeat family (TIGR03308; HMM-score: 134.3)
    2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase (TIGR03532; EC 2.3.1.89; HMM-score: 62.7)
    sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family (TIGR03570; HMM-score: 43.7)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesUDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR01173; EC 2.3.1.157,2.7.7.23; HMM-score: 37.8)
    Cell structureCell envelopeBiosynthesis and degradation of murein sacculus and peptidoglycanUDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR01173; EC 2.3.1.157,2.7.7.23; HMM-score: 37.8)
    MetabolismCentral intermediary metabolismAmino sugarsUDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR01173; EC 2.3.1.157,2.7.7.23; HMM-score: 37.8)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesUDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase LpxD (TIGR01853; EC 2.3.1.191; HMM-score: 32.5)
    glucose-1-phosphate thymidylyltransferase (TIGR01208; EC 2.7.7.24; HMM-score: 31.6)
    MetabolismAmino acid biosynthesisSerine familyserine O-acetyltransferase (TIGR01172; EC 2.3.1.30; HMM-score: 30.4)
    colanic acid biosynthesis acetyltransferase WcaF (TIGR04008; EC 2.3.1.-; HMM-score: 29.4)
    MetabolismEnergy metabolismOtherphenylacetic acid degradation protein PaaY (TIGR02287; HMM-score: 22.7)
    colanic acid biosynthesis acetyltransferase WcaB (TIGR04016; EC 2.3.1.-; HMM-score: 22.3)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesacyl-[acyl-carrier-protein]-UDP-N-acetylglucosamine O-acyltransferase (TIGR01852; EC 2.3.1.129; HMM-score: 18)
    UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR03992; EC 2.3.1.157,2.7.7.23; HMM-score: 11)
  • TheSEED:  
    Capsular polysaccharide synthesis enzyme Cap5H 
    O-acetyl transferase 
  • PFAM:
    HEXAPEP (CL0536) Hexapep; Bacterial transferase hexapeptide (six repeats) (PF00132; HMM-score: 50.1)
    Hexapep_2; Hexapeptide repeat of succinyl-transferase (PF14602; HMM-score: 25)
    no clan definedDUF411; Protein of unknown function, DUF (PF04214; HMM-score: 12.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.15
    • Ymax_pos: 19
    • Cmax: 0.126
    • Cmax_pos: 19
    • Smax: 0.212
    • Smax_pos: 2
    • Smean: 0.175
    • D: 0.16
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MRIAIEKIIGLLKNQSSKESNVKIHRLAYITNSKFDGNNYIDRWCKIRNSHIGEYSYIGFGSDFNNVEVGRYCSISSDVKIGLGKHPTHFFSSSPIFYSNNNPFNIKQKFIDFNDQPSRTTIKNDVWIGANVIIMDGLTINTGAVIAAGSVVTKNVGAYEVVGGVPAKVIKKRFDNKTIEKLLESKWWEKTPDKLKGFSVEYLNKKDT

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor: RpoF (SigB*) [4] [5] other strains
    RpoF  (SigB*) (sigma factor) controls a large regulon involved in stress/starvation response and adaptation
  • regulator: CodY
    CodY (TF) important in Amino acid metabolismRegPrecise    transcription unit transferred from N315 data RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J. Proteome Res.: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  4. Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J. Bacteriol.: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)
  5. Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
    The sigmaB regulon in Staphylococcus aureus and its regulation.
    Int. J. Med. Microbiol.: 2006, 296(4-5);237-58
    [PubMed:16644280] [WorldCat.org] [DOI] (P p)

Relevant publications[edit source | edit]