From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0147 [new locus tag: SACOL_RS00745 ]
  • pan locus tag?: SAUPAN000990000
  • symbol: cap5L
  • pan gene symbol?: capL
  • synonym:
  • product: capsular polysaccharide biosynthesis protein Cap5L

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL0147 [new locus tag: SACOL_RS00745 ]
  • symbol: cap5L
  • product: capsular polysaccharide biosynthesis protein Cap5L
  • replicon: chromosome
  • strand: +
  • coordinates: 164775..165980
  • length: 1206
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    1201
    ATGAGTGAAAAAAAGATTTTGATTTTATGTCAGTATTTTTATCCGGAATATGTATCTTCT
    GCGACGTTACCAACTCAATTGGCGGAAGATTTAATTGCGAATCACATTAATGTCGATGTC
    ATGTGTGGATGGCCATATGAATATAGTAATCATAAACAGGTTTCTAAAACCGAGATGCAT
    CGTGGTATTCGCATTCGACGTCTCAAGTATTCGAGGTTTAATAACAAAAGTAAGGTTGGA
    AGGATCATCAATTTCTTTAGTTTATTTTCAAAATTCGTGATTAATATACCTAAAATGTTG
    AAATATGATCAGATTCTTGTTTACTCTAATCCACCAATCTTGCCATTAATACCAGACGTT
    TTACACAGACTGCTTAAGAAAAAATATTCTTTTGTGGTGTATGATATAGCACCTGATAAT
    GCGATTAAGACAGGTGCAACTCGTCCAGGTAGCATGATTGATAAGCTGATGCGTTACATT
    AATAGACATGTCTACAAGAATGCTGAAAATGTCATTGTCCTTGGTACGGAAATGAAAAAC
    TACTTACTAAATCATCAAATTTCTAAAAATGCTGACAATATCCATGTGATTCCTAACTGG
    TATGACATGCGTCAATTACAAGACAATCGTATCTATAATGACACATTTAAAGCTTACCGT
    GAGCAATACGACAAAATTTTATTGTATAGCGGTAATATGGGGCAGTTACAGGATATGGAG
    ACACTTATCTCATTTTTAAAATTAAATAAGGATCAGTCTCAAACGTTAACAATACTTTGT
    GGTCATGGTAAGAAATTTGCAGATGTCAAAACGGCAATAGAAGACCATCGTATTGAAAAT
    GTTAAAATGTTTGAGTTTTTAACAGGTACAGACTATGCTGACGTATTAAAAATTGCGGAT
    GTATGTATTGCATCGCTGATTAAAGAAGGCGTCGGTTTAGGCGTGCCGAGCAAGAATTAT
    GGCTATCTTGCAGCTAAGAAAGCGTTGGTACTCATCATGGATAAGCAATCTGATATCGTT
    CAACATGTTGAACAATATGATGCGGGTATCCAAATTGATAATGGCGATGCACATGCCATT
    TATAACTTCATCAACACTCACTCGAGTAAGGAATTGCACGAGATGGGTGAGCGCGCACAT
    CAACTGTTTAAAGATAAATATACGAGAGAAATTAATACTATGAAGTATTACAATCTGTTG
    AAGTGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1200
    1206

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL0147 [new locus tag: SACOL_RS00745 ]
  • symbol: Cap5L
  • description: capsular polysaccharide biosynthesis protein Cap5L
  • length: 401
  • theoretical pI: 9.38788
  • theoretical MW: 46576.6
  • GRAVY: -0.34414

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    colanic acid biosynthesis glycosyltransferase WcaI (TIGR04007; EC 2.4.-.-; HMM-score: 49.7)
    PEP-CTERM/exosortase A-associated glycosyltransferase, Daro_2409 family (TIGR04063; EC 2.4.-.-; HMM-score: 36)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersGlutathione and analogsN-acetyl-alpha-D-glucosaminyl L-malate synthase BshA (TIGR03999; EC 2.4.1.-; HMM-score: 31.2)
    MetabolismEnergy metabolismBiosynthesis and degradation of polysaccharidesglycogen synthase, Corynebacterium family (TIGR02149; HMM-score: 21.6)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidessurface carbohydrate biosynthesis protein (TIGR04396; HMM-score: 20.4)
  • TheSEED:  
    Capsular polysaccharide synthesis enzyme Cap5L 
  • PFAM:
    GT-B (CL0113) Glycos_transf_1; Glycosyl transferases group 1 (PF00534; HMM-score: 32.9)
    Glyco_transf_4; Glycosyltransferase Family 4 (PF13439; HMM-score: 27.1)
    Glyco_trans_4_4; Glycosyl transferase 4-like domain (PF13579; HMM-score: 23.6)
    Peptidase_CD (CL0093) Peptidase_C11; Clostripain family (PF03415; HMM-score: 11.9)
    no clan definedDUF4441; Domain of unknown function (DUF4441) (PF14536; HMM-score: 11.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.163
    • Ymax_pos: 29
    • Cmax: 0.144
    • Cmax_pos: 29
    • Smax: 0.259
    • Smax_pos: 20
    • Smean: 0.151
    • D: 0.158
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MSEKKILILCQYFYPEYVSSATLPTQLAEDLIANHINVDVMCGWPYEYSNHKQVSKTEMHRGIRIRRLKYSRFNNKSKVGRIINFFSLFSKFVINIPKMLKYDQILVYSNPPILPLIPDVLHRLLKKKYSFVVYDIAPDNAIKTGATRPGSMIDKLMRYINRHVYKNAENVIVLGTEMKNYLLNHQISKNADNIHVIPNWYDMRQLQDNRIYNDTFKAYREQYDKILLYSGNMGQLQDMETLISFLKLNKDQSQTLTILCGHGKKFADVKTAIEDHRIENVKMFEFLTGTDYADVLKIADVCIASLIKEGVGLGVPSKNYGYLAAKKALVLIMDKQSDIVQHVEQYDAGIQIDNGDAHAIYNFINTHSSKELHEMGERAHQLFKDKYTREINTMKYYNLLK

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor: RpoF (SigB*) [3] [4] other strains
    RpoF  (SigB*) (sigma factor) controls a large regulon involved in stress/starvation response and adaptation
  • regulator: CodY
    CodY (TF) important in Amino acid metabolism

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  3. Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J. Bacteriol.: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)
  4. Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
    The sigmaB regulon in Staphylococcus aureus and its regulation.
    Int. J. Med. Microbiol.: 2006, 296(4-5);237-58
    [PubMed:16644280] [WorldCat.org] [DOI] (P p)

Relevant publications[edit source | edit]