From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0484 [new locus tag: SACOL_RS02450 ]
  • pan locus tag?: SAUPAN002148000
  • symbol: SACOL0484
  • pan gene symbol?: lpl7
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL0484 [new locus tag: SACOL_RS02450 ]
  • symbol: SACOL0484
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 485794..486609
  • length: 816
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGATGGGGTATATAAAAAGAATGGCTTTATACATGAGTGTATTTCTTTTAATCATTTTT
    ATTGTTGGATGTCGAAATATGAAAGATGAACAGAAAAAAGAAGAACAAACAAATAAAACA
    GATTCAAAAGAAGAACAAATCAAAAAGAGTTTTGAGAAAACATTAGATATGTATCCAATT
    AAGAATCTCGAGGAGTTATACGACAAAGAAGGATACCGAGATGGCGAATTTAAAAAGGGT
    GATAAAGGGATGTGGACGATATATACAGATTTCGCCAAAAGTAATAAACAAGGTGGATTG
    AGTAATGAAGGTATGGTCTTATACTTAGATAGAAATACACGGACTGCAAAGGGACATTAT
    TTTGTTAAGACATTCTATAATAAGGGCAAATTCCCAGATAGAAAAAATTATAAAGTTGAA
    ATGAAAAATAATAAAATTATCTTATTAGATAAAGTAGAAGATACAAATCTAAAAAAGAGA
    ATAGAAAACTTTAAATTTTTTGGACAATATGCAAACCTTAAAGAATTGAAAAACTACAAC
    AATGGTGATGTCTCAATTAATGAGAATGTTCCAAGTTATGACGCAAAATTTAAAATGAGC
    AATAAAGATGAAAATGTTAAGCAATTAAGAAGTCGTTATAATATTCCTACTGATAAAGCA
    CCGGTATTAAAAATGCATATTGATGGTAATTTGAAAGGAAGTTCTGTGGGTTATAAAAAG
    TTGGAAATTGACTTTTCAAAAGGTGGAAAAAGCGATTTGTCAGTAATAGATTCTTTGAAT
    TTCCAGCCGGCGAAGGTAGATGAAGATGATGAATGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    816

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL0484 [new locus tag: SACOL_RS02450 ]
  • symbol: SACOL0484
  • description: hypothetical protein
  • length: 271
  • theoretical pI: 9.6824
  • theoretical MW: 31631
  • GRAVY: -0.906273

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Staphylococcus tandem lipoproteins (TIGR01742; HMM-score: 421.6)
  • TheSEED:  
    Tandem lipoprotein within Pathogenicity island 
  • PFAM:
    LolA_LolB (CL0048) DUF576; Csa1 family (PF04507; HMM-score: 370.5)
    Adhesin (CL0204) DUF2807; Putative auto-transporter adhesin, head GIN domain (PF10988; HMM-score: 13)
    no clan definedETRAMP; Malarial early transcribed membrane protein (ETRAMP) (PF09716; HMM-score: 12.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helix: 1
  • LocateP: Lipid anchored
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPII)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: 0
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: IFIVGCR
  • SignalP: no predicted signal peptide
    • Ymax: 0.382
    • Ymax_pos: 33
    • Cmax: 0.23
    • Cmax_pos: 33
    • Smax: 0.762
    • Smax_pos: 27
    • Smean: 0.507
    • D: 0.431
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MMGYIKRMALYMSVFLLIIFIVGCRNMKDEQKKEEQTNKTDSKEEQIKKSFEKTLDMYPIKNLEELYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFYNKGKFPDRKNYKVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGGKSDLSVIDSLNFQPAKVDEDDE

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J. Proteome Res.: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]