From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0604 [new locus tag: SACOL_RS03125 ]
  • pan locus tag?: SAUPAN002330000
  • symbol: SACOL0604
  • pan gene symbol?: dgk
  • synonym:
  • product: deoxynucleoside kinase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL0604 [new locus tag: SACOL_RS03125 ]
  • symbol: SACOL0604
  • product: deoxynucleoside kinase
  • replicon: chromosome
  • strand: -
  • coordinates: 629392..630009
  • length: 618
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGAACAAACCTTTTATAGCAATTGAAGGTCCTATTGGCGTAGGTAAATCTTCACTTGCA
    CACAAATTAAGTCAAACTTTAGATTTTTATGAAGAAAAAGAAATCATCACAGAAAATCCA
    TTTTTATCAGACTTTTATGAAGATATCTCTAAATGGAGTTTTCAAACTGAAATGTTCTTT
    TTATGCAATAGATATAAGCAATTTCAAGATGTAACACAACTAAATCAAGGTGTAGTTAGT
    GATTATCATATACATAAAAATAAGATATTTGCTAAAAATACTTTGAGTTCTGTTGAATTT
    CAGAAATTCAGTAAAATTTATGATATTTTAACTGAAGATATGATTATGCCGAATATGATT
    ATCTTTTTAGATGCAGACCTTGATGTGTTAAAATCTAGAATTGCTAAACGTAACCGTAGT
    TTTGAGCATCAAATAGAAGATGAATATCTGTTAAAGTTAAAAAAAGATTATCGTGAGTAT
    TATGAGTCCTTACAAAGTAATGGTTCAAATGTAGTTTTAATCGATACAACTTCTATTGAT
    TTTCTTAAAAATGAACAAGATTACGAAGATATATTACATATTATATTACCTATGATAGGA
    GATATTACCAATGAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    618

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL0604 [new locus tag: SACOL_RS03125 ]
  • symbol: SACOL0604
  • description: deoxynucleoside kinase
  • length: 205
  • theoretical pI: 4.5954
  • theoretical MW: 24153.3
  • GRAVY: -0.377073

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesNucleotide and nucleoside interconversionsdTMP kinase (TIGR00041; EC 2.7.4.9; HMM-score: 44)
    putative cytidylate kinase (TIGR02173; EC 2.7.4.14; HMM-score: 25.1)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesNucleotide and nucleoside interconversionscytidylate kinase (TIGR00017; EC 2.7.4.14; HMM-score: 20.5)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesNucleotide and nucleoside interconversionsguanylate kinase (TIGR03263; EC 2.7.4.8; HMM-score: 16.4)
    MetabolismCentral intermediary metabolismPhosphorus compoundsphosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN (TIGR02322; HMM-score: 15.8)
    carbohydrate kinase, thermoresistant glucokinase family (TIGR01313; EC 2.7.1.-; HMM-score: 12.4)
  • TheSEED:  
    Nucleosides and NucleotidesPurinesPurine conversions Deoxyguanosine kinase (EC 2.7.1.113) 
  • PFAM:
    P-loop_NTPase (CL0023) dNK; Deoxynucleoside kinase (PF01712; HMM-score: 155.8)
    Thymidylate_kin; Thymidylate kinase (PF02223; HMM-score: 39.9)
    AAA_18; AAA domain (PF13238; HMM-score: 34.5)
    AAA_33; AAA domain (PF13671; HMM-score: 31)
    Cytidylate_kin; Cytidylate kinase (PF02224; HMM-score: 18.7)
    SKI; Shikimate kinase (PF01202; HMM-score: 17.9)
    AAA_22; AAA domain (PF13401; HMM-score: 17.9)
    AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 17.9)
    AAA_17; AAA domain (PF13207; HMM-score: 15.6)
    RNA_helicase; RNA helicase (PF00910; HMM-score: 15.3)
    AAA_14; AAA domain (PF13173; HMM-score: 14.8)
    ABC_tran; ABC transporter (PF00005; HMM-score: 14.2)
    AAA_28; AAA domain (PF13521; HMM-score: 13.5)
    NACHT; NACHT domain (PF05729; HMM-score: 12.8)
    MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 12.8)
    AAA_16; AAA ATPase domain (PF13191; HMM-score: 12.4)
    PreATP-grasp (CL0483) GSH_synth_ATP; Eukaryotic glutathione synthase, ATP binding domain (PF03917; HMM-score: 11.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.134
    • Ymax_pos: 20
    • Cmax: 0.112
    • Cmax_pos: 20
    • Smax: 0.222
    • Smax_pos: 19
    • Smean: 0.158
    • D: 0.143
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNKPFIAIEGPIGVGKSSLAHKLSQTLDFYEEKEIITENPFLSDFYEDISKWSFQTEMFFLCNRYKQFQDVTQLNQGVVSDYHIHKNKIFAKNTLSSVEFQKFSKIYDILTEDMIMPNMIIFLDADLDVLKSRIAKRNRSFEHQIEDEYLLKLKKDYREYYESLQSNGSNVVLIDTTSIDFLKNEQDYEDILHIILPMIGDITNE

Experimental data[edit source | edit]

  • experimentally validated: PeptideAtlas
    experimental localization: Cytoplasmic [1] [2] [3]
    quantitative data / protein copy number per cell: 38 [4]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J. Proteome Res.: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  4. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]