From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0688 [new locus tag: SACOL_RS03540 ]
  • pan locus tag?: SAUPAN002507000
  • symbol: SACOL0688
  • pan gene symbol?: mntC
  • synonym:
  • product: ABC transporter substrate-binding protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL0688 [new locus tag: SACOL_RS03540 ]
  • symbol: SACOL0688
  • product: ABC transporter substrate-binding protein
  • replicon: chromosome
  • strand: -
  • coordinates: 712981..713910
  • length: 930
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    ATGAAAAAATTAGTACCTTTATTATTAGCCTTATTACTTCTAGTTGCTGCATGTGGTACT
    GGTGGTAAACAAAGCAGTGATAAGTCAAATGGCAAATTAAAAGTAGTAACGACGAATTCA
    ATTTTATATGATATGGCTAAAAATGTTGGTGGAGACAACGTCGATATTCATAGTATTGTA
    CCTGTTGGTCAAGATCCTCATGAATATGAAGTTAAACCTAAAGATATTAAAAAGTTAACT
    GACGCTGACGTTATTTTATACAACGGATTAAATTTAGAGACTGGTAACGGTTGGTTTGAA
    AAAGCCTTAGAACAGGCTGGTAAATCATTAAAAGATAAAAAAGTTATCGCAGTATCAAAA
    GATGTTAAACCTATCTATTTAAACGGTGAAGAAGGCAACAAAGATAAACAAGATCCACAC
    GCATGGTTAAGTTTAGATAACGGTATTAAATACGTAAAAACAATTCAACAAACATTTATC
    GATAACGACAAAAAACATAAAGCAGATTATGAAAAGCAAGGTAACAAATACATTGCTCAA
    TTGGAAAAATTAAATAATGACAGTAAAGACAAATTTAATGACATTCCAAAAGAACAACGT
    GCCATGATTACAAGTGAAGGTGCCTTCAAGTACTTCTCAAAACAATACGGTATTACACCA
    GGTTATATTTGGGAAATTAACACTGAAAAACAAGGTACACCTGAACAAATGAGACAAGCT
    ATTGAGTTTGTTAAAAAGCACAAATTAAAACACTTATTAGTAGAAACAAGTGTTGATAAG
    AAAGCAATGGAAAGTTTATCTGAAGAAACGAAGAAAGATATCTTTGGTGAAGTGTACACA
    GATTCAATCGGTAAAGAAGGCACTAAAGGTGACTCTTACTACAAAATGATGAAATCAAAT
    ATTGAAACTGTACACGGAAGCATGAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    930

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL0688 [new locus tag: SACOL_RS03540 ]
  • symbol: SACOL0688
  • description: ABC transporter substrate-binding protein
  • length: 309
  • theoretical pI: 9.16314
  • theoretical MW: 34740.5
  • GRAVY: -0.703236

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsUnknown substrateanchored repeat ABC transporter, substrate-binding protein (TIGR03772; HMM-score: 125.7)
  • TheSEED:  
    Manganese ABC transporter, periplasmic-binding protein SitA 
  • PFAM:
    Chelatase (CL0043) ZnuA; Zinc-uptake complex component A periplasmic (PF01297; HMM-score: 243.6)
    GlnB-like (CL0089) Nit_Regul_Hom; Uncharacterized protein, homolog of nitrogen regulatory protein PII (PF10126; HMM-score: 17.2)
    no clan definedDUF1454; Protein of unknown function (DUF1454) (PF07305; HMM-score: 13.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:
    SACOL1637(dnaK)molecular chaperone DnaK  [1] (data from MRSA252)
    SACOL0969(spsB)signal peptidase IB  [1] (data from MRSA252)
    SACOL2173alkaline shock protein 23  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 9.68
    • Cellwall Score: 0.17
    • Extracellular Score: 0.16
    • Internal Helix: 1
  • LocateP: Lipid anchored
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPII)
    • Intracellular Possibility: -0.33
    • Signal Peptide Possibility: 1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: LLVAACG
  • SignalP: Signal peptide length 26 aa
    • Ymax: 0.362
    • Ymax_pos: 26
    • Cmax: 0.185
    • Cmax_pos: 26
    • Smax: 0.933
    • Smax_pos: 2
    • Smean: 0.804
    • D: 0.535
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKKLVPLLLALLLLVAACGTGGKQSSDKSNGKLKVVTTNSILYDMAKNVGGDNVDIHSIVPVGQDPHEYEVKPKDIKKLTDADVILYNGLNLETGNGWFEKALEQAGKSLKDKKVIAVSKDVKPIYLNGEEGNKDKQDPHAWLSLDNGIKYVKTIQQTFIDNDKKHKADYEKQGNKYIAQLEKLNNDSKDKFNDIPKEQRAMITSEGAFKYFSKQYGITPGYIWEINTEKQGTPEQMRQAIEFVKKHKLKHLLVETSVDKKAMESLSEETKKDIFGEVYTDSIGKEGTKGDSYYKMMKSNIETVHGSMK

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: SirR (MntR*)
    SirR  (MntR*) (TF) important in Manganese homeostasisRegPrecise    transcription unit transferred from N315 data RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.0 1.1 1.2 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)
  2. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  3. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]