From AureoWiki
Jump to: navigation, search

NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0958 [new locus tag: SACOL_RS04910 ]
  • pan locus tag?: SAUPAN003057000
  • symbol: SACOL0958
  • pan gene symbol?:
  • synonym:
  • product: general stress protein 13

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL0958 [new locus tag: SACOL_RS04910 ]
  • symbol: SACOL0958
  • product: general stress protein 13
  • replicon: chromosome
  • strand: +
  • coordinates: 959155..959532
  • length: 378
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    TTGAATAACTACAAAATTGGCCAACATATCAAGGTGCGTGTAACTGGTATTCAACCATAC
    GGTGCGTTTGTTGAGACCCCTAATCATACTGAAGGACTGATTCATATATCAGAAATTATG
    GATGACTACGTTCATAATTTGAAGAAATTTCTATCAGAAGGCCAAATTGTTAAAGCTAAA
    ATTTTGTCTATAGATGATGAAGGAAAGCTTAATCTATCATTAAAGGATAATGATTACTTC
    AAAAATTATGAGCGTAAGAAGGAAAAACAATCAGTATTAGATGAAATCAGAGAAACAGAA
    AAATATGGGTTTCAAACACTTAAAGAACGCTTACCAATCTGGATAAAACAGTCAAAGCGA
    GCAATTCGAAACGACTAA
    60
    120
    180
    240
    300
    360
    378

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL0958 [new locus tag: SACOL_RS04910 ]
  • symbol: SACOL0958
  • description: general stress protein 13
  • length: 125
  • theoretical pI: 9.53333
  • theoretical MW: 14722.7
  • GRAVY: -0.8016

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal protein bS1 (TIGR00717; HMM-score: 60.4)
    Genetic information processingTranscriptionDegradation of RNApolyribonucleotide nucleotidyltransferase (TIGR03591; EC 2.7.7.8; HMM-score: 58.5)
    and 5 more
    Genetic information processingTranscriptionDegradation of RNAribonuclease R (TIGR02063; EC 3.1.-.-; HMM-score: 30.6)
    guanosine pentaphosphate synthetase I/polyribonucleotide nucleotidyltransferase (TIGR02696; EC 2.7.-.-,2.7.7.8; HMM-score: 22.4)
    Genetic information processingTranscriptionDegradation of RNAribonuclease, Rne/Rng family (TIGR00757; EC 3.1.4.-; HMM-score: 13.5)
    Genetic information processingTranscriptionDNA-dependent RNA polymeraseDNA-directed RNA polymerase (TIGR00448; EC 2.7.7.6; HMM-score: 13.2)
    Genetic information processingTranscriptionDegradation of RNAVacB and RNase II family 3'-5' exoribonucleases (TIGR00358; EC 3.1.13.1; HMM-score: 13)
  • TheSEED:  
    General stress protein 13 
  • PFAM:
    OB (CL0021) S1; S1 RNA binding domain (PF00575; HMM-score: 51.8)
    and 2 more
    no clan definedUAE_UbL; Ubiquitin/SUMO-activating enzyme ubiquitin-like domain (PF14732; HMM-score: 18.3)
    TRB (CL0206) BPL_C; Biotin protein ligase C terminal domain (PF02237; HMM-score: 15.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.13
    • Ymax_pos: 23
    • Cmax: 0.116
    • Cmax_pos: 60
    • Smax: 0.249
    • Smax_pos: 1
    • Smean: 0.147
    • D: 0.136
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNNYKIGQHIKVRVTGIQPYGAFVETPNHTEGLIHISEIMDDYVHNLKKFLSEGQIVKAKILSIDDEGKLNLSLKDNDYFKNYERKKEKQSVLDEIRETEKYGFQTLKERLPIWIKQSKRAIRND

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]