From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1150 [new locus tag: SACOL_RS05875 ]
  • pan locus tag?: SAUPAN003376000
  • symbol: rnhC
  • pan gene symbol?: rnhC
  • synonym:
  • product: ribonuclease HIII

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL1150 [new locus tag: SACOL_RS05875 ]
  • symbol: rnhC
  • product: ribonuclease HIII
  • replicon: chromosome
  • strand: -
  • coordinates: 1159176..1160114
  • length: 939
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    ATGGCGAATATCGTTTTTAAATTGTCGGATAAAGACATAACGACATTAATGTCACGCATT
    TCTTTTGATACTGAGAATTTACCTCAAGGTATGAAAGCACGTGCAAAGTATCAAAATACA
    ACTGTAAATATTTACCAATCAGGTAAAGTCATGTTTCAAGGTAATCATGCAGAAGCTGTG
    TCTGAAGAACTTCTACCGCAGCATTCTCAATTGAATACTAATAAAACTAAAAAGAAAAAT
    ATGGCTAATTCTTTTCTTGAACAAACTTTAATGTATGATCAATTTAACTGTATTGGTAGT
    GATGAGGCTGGAAGTGGCGATTACTTTGGTCCGTTGACTGTGTGTGCTGCTTTCGTTACC
    AAAGAGCATGTCCCTATTTTAAAAACTTTGGGTGTAGATGATTCAAAAAAATTAACCGAT
    ACCAAAATTGTAGAACTTGCTGAGCAATTGGTTACTTTCATACCACATTCATTATTAACA
    CTACACAATGAAAAATATAATATTCAGCAAGCAAAAGGCTGGACTCAAGTAAAAATGAAA
    GCTGCCCTTCATAATGAAGCCATCAAAAATGTACTTGAAAAAATTGATTCGTCTCAATTA
    GACTATATCGTCATTGATCAGTTCGCAAAACGCGAAGTGTATAGCCATTACGCATTATCA
    GATATACCACTTCCAAAGAAAACAAAATTTGAAACAAAAGGAGAATCGAAGTCATTAGCC
    ATTGCAGTGGCAAGCATAATTTCTCGATACGCATTTGTTACATATATGGATCAAATATCA
    AAAAATATTAATATGACGATTCCTAAAGGTGCCGGTGCTAAAGTCGATGTAATCGCCGCC
    AAAATTATAAAAAAATACGGTCTTTCACGTTTAGATACCATTTCAAAAAAGCATTTTAAA
    AATCGTGAAAAAGCCCAAAAAATTTTAAAGCCTCTTTGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    939

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL1150 [new locus tag: SACOL_RS05875 ]
  • symbol: RnhC
  • description: ribonuclease HIII
  • length: 312
  • theoretical pI: 9.93953
  • theoretical MW: 35054.3
  • GRAVY: -0.333333

Function[edit source | edit]

  • reaction:
    EC 3.1.26.4?  ExPASy
    Ribonuclease HEndonucleolytic cleavage to 5'-phosphomonoester
  • TIGRFAM:
    Genetic information processingDNA metabolismDNA replication, recombination, and repairribonuclease HIII (TIGR00716; EC 3.1.26.4; HMM-score: 230.5)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairribonuclease HII (TIGR00729; EC 3.1.26.4; HMM-score: 63)
  • TheSEED:  
    RNA MetabolismRNA processing and modificationRibonuclease H Ribonuclease HIII (EC 3.1.26.4) 
    CBSS-198094.1.peg.4426 Ribonuclease HIII (EC 3.1.26.4) 
  • PFAM:
    RNase_H (CL0219) RNase_HII; Ribonuclease HII (PF01351; HMM-score: 162.4)
    TBP-like (CL0407) DUF3378; Domain of unknown function (DUF3378) (PF11858; HMM-score: 75.4)
    TBP; Transcription factor TFIID (or TATA-binding protein, TBP) (PF00352; HMM-score: 13.7)
    no clan definedDUF1160; Protein of unknown function (DUF1160) (PF06648; HMM-score: 11.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: Mg2+, Mn2+
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.22
    • Ymax_pos: 34
    • Cmax: 0.271
    • Cmax_pos: 60
    • Smax: 0.42
    • Smax_pos: 31
    • Smean: 0.213
    • D: 0.217
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MANIVFKLSDKDITTLMSRISFDTENLPQGMKARAKYQNTTVNIYQSGKVMFQGNHAEAVSEELLPQHSQLNTNKTKKKNMANSFLEQTLMYDQFNCIGSDEAGSGDYFGPLTVCAAFVTKEHVPILKTLGVDDSKKLTDTKIVELAEQLVTFIPHSLLTLHNEKYNIQQAKGWTQVKMKAALHNEAIKNVLEKIDSSQLDYIVIDQFAKREVYSHYALSDIPLPKKTKFETKGESKSLAIAVASIISRYAFVTYMDQISKNINMTIPKGAGAKVDVIAAKIIKKYGLSRLDTISKKHFKNREKAQKILKPL

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • rnhC no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J. Proteome Res.: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]