From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1158 [new locus tag: SACOL_RS05915 ]
  • pan locus tag?: SAUPAN003387000
  • symbol: sdhC
  • pan gene symbol?: sdhC
  • synonym:
  • product: succinate dehydrogenase, cytochrome b558 subunit

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL1158 [new locus tag: SACOL_RS05915 ]
  • symbol: sdhC
  • product: succinate dehydrogenase, cytochrome b558 subunit
  • replicon: chromosome
  • strand: +
  • coordinates: 1168331..1168945
  • length: 615
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    TTGGCTCAATCAAAAAATGAATTTTATCTAAGACGTATTCACTCGTTATTAGGTATTATC
    CCAATAGGTGCATTTTTGGTCGTTCATTTATTAGTGAATCACCAAGCAACACAAGGTGCT
    GAAGCGTTTAATAAGGCATCTAACTTTATGGAATCATTACCATTTCTAATTATTGTAGAA
    TTTTTATTTATATACATTCCGTTGTTATATCACGGTTTGTTTGGTATACACATTGCATTT
    ACAGCAAAAGAAAATGTTGGACATTACTCGATTTTTAGAAACTGGATGTTCTTCTTCCAA
    AGAGTGAGTGGTATCTTAACATTTATCTTTATTGGTATCCATTTATGGCAAACACGTTTA
    CAAAAAGCATTTTACGGCAAAGAAGTGAATTACGATTTAATGCACGAAACATTGCAACAT
    CCTGGATGGGCAATATTTTATATTATTTGTATTATTGCTGTTGTGTTCCACTTTGCAAAT
    GGCTTATGGTCATTCTTAGTTACTTGGGGTGGACTTCAATCTCCAAAATCACAACGAGTA
    TTTACATGGGTTTCATTAATCGTATTTTTAGTTATTTCGTATATTGGTGTTACTGCAATT
    ATTGCCTTTATGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    615

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL1158 [new locus tag: SACOL_RS05915 ]
  • symbol: SdhC
  • description: succinate dehydrogenase, cytochrome b558 subunit
  • length: 204
  • theoretical pI: 9.57454
  • theoretical MW: 23598.8
  • GRAVY: 0.720588

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismEnergy metabolismTCA cyclesuccinate dehydrogenase (or fumarate reductase) cytochrome b subunit, b558 family (TIGR02046; HMM-score: 143.1)
    MetabolismEnergy metabolismTCA cyclesuccinate dehydrogenase, cytochrome b556 subunit (TIGR02970; HMM-score: 53.4)
    MetabolismEnergy metabolismTCA cyclesuccinate dehydrogenase, hydrophobic membrane anchor protein (TIGR02968; HMM-score: 20.4)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingmembrane protein insertase, YidC/Oxa1 family (TIGR03592; HMM-score: 10.9)
  • TheSEED:  
    RespirationElectron donating reactionsSuccinate dehydrogenase Succinate dehydrogenase cytochrome b558 subunit 
  • PFAM:
    FumRed-TM (CL0335) Sdh_cyt; Succinate dehydrogenase/Fumarate reductase transmembrane subunit (PF01127; HMM-score: 60.5)
    no clan definedDUF2177; Predicted membrane protein (DUF2177) (PF09945; HMM-score: 16.8)
    FumRed-TM (CL0335) DUF1691; Protein of unknown function (DUF1691) (PF07950; HMM-score: 10.7)
    Yip1 (CL0112) Yip1; Yip1 domain (PF04893; HMM-score: 8.9)
    no clan definedWTF; WTF protein (PF03303; HMM-score: 7.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 5
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.344
    • Ymax_pos: 43
    • Cmax: 0.283
    • Cmax_pos: 43
    • Smax: 0.681
    • Smax_pos: 34
    • Smean: 0.294
    • D: 0.324
  • predicted transmembrane helices (TMHMM): 5

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MAQSKNEFYLRRIHSLLGIIPIGAFLVVHLLVNHQATQGAEAFNKASNFMESLPFLIIVEFLFIYIPLLYHGLFGIHIAFTAKENVGHYSIFRNWMFFFQRVSGILTFIFIGIHLWQTRLQKAFYGKEVNYDLMHETLQHPGWAIFYIICIIAVVFHFANGLWSFLVTWGGLQSPKSQRVFTWVSLIVFLVISYIGVTAIIAFM

Experimental data[edit source | edit]

  • experimentally validated: PeptideAtlas
    experimental localization: Integral membrane [1]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]