From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1166 [new locus tag: SACOL_RS05960 ]
  • pan locus tag?: SAUPAN003398000
  • symbol: SACOL1166
  • pan gene symbol?: flr
  • synonym:
  • product: formyl peptide receptor-like 1 inhibitory protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL1166 [new locus tag: SACOL_RS05960 ]
  • symbol: SACOL1166
  • product: formyl peptide receptor-like 1 inhibitory protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1174896..1175297
  • length: 402
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    ATGAAAAAAAATATCACAAAAACTATTATCGCATCTACAGTAATCGCTGCAGGTCTTTTA
    ACTCAAACTAATGATGCTAAAGCTTTCTTTAGTTATGAATGGAAAGGTTTAGAAATCGCA
    AAAAATTTAGCAGATCAAGCTAAAAAGGACGATGAACGTATTGATAAGTTAATGAAAGAG
    TCTGATAAAAATCTAACTCCTTACAAAGCTGAAACTGTTAATGATCTGTACCTTATTGTT
    AAAAAATTAAGCCAAGGTGATGTGAAGAAAGCAGTTGTCAGAATTAAAGATGGTGGTCCT
    AGAGATTACTATACTTTTGACTTAACTCGTCCTTTAGAAGAGAACAGAAAAAATATTAAA
    GTTGTTAAAAACGGTGAAATCGACTCGATTACTTGGTATTAA
    60
    120
    180
    240
    300
    360
    402

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL1166 [new locus tag: SACOL_RS05960 ]
  • symbol: SACOL1166
  • description: formyl peptide receptor-like 1 inhibitory protein
  • length: 133
  • theoretical pI: 9.83172
  • theoretical MW: 15202.4
  • GRAVY: -0.614286

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    FIG017917: hypothetical protein 
  • PFAM:
    no clan definedFPRL1_inhibitor; Formyl peptide receptor-like 1 inhibitory protein (PF16104; HMM-score: 236.5)
    Ubiquitin (CL0072) CHIPS; Chemotaxis-inhibiting protein CHIPS (PF11434; HMM-score: 14.7)
    no clan definedYlzJ; YlzJ-like protein (PF14035; HMM-score: 12.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 3.33
    • Cellwall Score: 3.33
    • Extracellular Score: 3.33
    • Internal Helices: 0
  • LocateP: Secretory(released) (with CS)
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: -0.17
    • Signal Peptide Possibility: 1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: NDAKAFFS
  • SignalP: Signal peptide length 29 aa
    • Ymax: 0.611
    • Ymax_pos: 29
    • Cmax: 0.727
    • Cmax_pos: 29
    • Smax: 0.757
    • Smax_pos: 6
    • Smean: 0.611
    • D: 0.611
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKKNITKTIIASTVIAAGLLTQTNDAKAFFSYEWKGLEIAKNLADQAKKDDERIDKLMKESDKNLTPYKAETVNDLYLIVKKLSQGDVKKAVVRIKDGGPRDYYTFDLTRPLEENRKNIKVVKNGEIDSITWY

Experimental data[edit source | edit]

  • experimentally validated: PeptideAtlas
    experimental localization: Cytoplasmic [1]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL1166 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]