From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1263 [new locus tag: SACOL_RS06450 ]
  • pan locus tag?: SAUPAN003538000
  • symbol: sucD
  • pan gene symbol?: sucD
  • synonym:
  • product: succinyl-CoA synthetase subunit alpha

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL1263 [new locus tag: SACOL_RS06450 ]
  • symbol: sucD
  • product: succinyl-CoA synthetase subunit alpha
  • replicon: chromosome
  • strand: +
  • coordinates: 1271840..1272748
  • length: 909
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    ATGAGTGTATTTATAGATAAGAATACTAAAGTAATGGTACAAGGTATTACAGGGTCTACT
    GCCCTTTTCCATACAAAACAAATGCTTGATTATGGTACGAAAATAGTAGCAGGTGTGACG
    CCTGGTAAAGGTGGTCAAGTTGTTGAAGGCGTTCCTGTTTTCAACACTGTTGAAGAAGCT
    AAAAATGAAACTGGGGCAACGGTTTCAGTCATTTACGTTCCAGCACCATTTGCTGCAGAC
    TCAATTTTAGAAGCAGCTGATGCAGACTTAGATATGGTTATTTGTATCACTGAACATATT
    CCTGTATTAGACATGGTTAAAGTTAAACGCTACTTACAAGGTAGAAAAACACGTTTAGTT
    GGTCCGAACTGTCCAGGTGTGATTACAGCAGATGAATGTAAAATTGGTATTATGCCTGGC
    TATATTCACAAAAAAGGTCATGTTGGTGTAGTATCTCGTTCAGGTACATTAACATATGAA
    GCAGTGCACCAATTGACTGAAGAAGGTATTGGTCAAACTACAGCTGTTGGTATTGGTGGA
    GACCCAGTCAACGGAACAAACTTTATTGATGTTTTAAAAGCATTCAATGAAGATGACGAA
    ACGAAAGCAGTTGTTATGATTGGTGAAATCGGTGGTACGGCTGAAGAAGAAGCAGCTGAA
    TGGATTAAAGCGAATATGACAAAACCAGTTGTAGGCTTTATCGGTGGACAAACAGCACCT
    CCTGGAAAACGTATGGGACATGCTGGTGCAATCATTTCAGGTGGTAAAGGTACTGCTGAA
    GAGAAAATTAAAACATTAAATAGTTGTGGTGTGAAAACAGCGGCAACACCTTCAGAAATT
    GGTTCAACATTAATTGAAGCTGCTAAAGAAGCAGGTATTTATGAATCATTATTAACTGTT
    AATAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    909

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL1263 [new locus tag: SACOL_RS06450 ]
  • symbol: SucD
  • description: succinyl-CoA synthetase subunit alpha
  • length: 302
  • theoretical pI: 5.40845
  • theoretical MW: 31542
  • GRAVY: 0.0354305

Function[edit source | edit]

  • reaction:
    EC 6.2.1.5?  ExPASy
    Succinate--CoA ligase (ADP-forming)ATP + succinate + CoA = ADP + phosphate + succinyl-CoA
  • TIGRFAM:
    MetabolismEnergy metabolismTCA cyclesuccinate-CoA ligase, alpha subunit (TIGR01019; EC 6.2.1.-; HMM-score: 479.4)
    acetyl coenzyme A synthetase (ADP forming), alpha domain (TIGR02717; EC 6.2.1.13; HMM-score: 64.3)
  • TheSEED:  
    CarbohydratesCentral carbohydrate metabolismDehydrogenase complexes Succinyl-CoA ligase [ADP-forming] alpha chain (EC 6.2.1.5) 
    Central carbohydrate metabolismTCA Cycle Succinyl-CoA ligase [ADP-forming] alpha chain (EC 6.2.1.5) 
    One-carbon MetabolismSerine-glyoxylate cycle Succinyl-CoA ligase [ADP-forming] alpha chain (EC 6.2.1.5) 
  • PFAM:
    NADP_Rossmann (CL0063) CoA_binding; CoA binding domain (PF02629; HMM-score: 102.9)
    Succ_CoA_synth (CL0506) Ligase_CoA; CoA-ligase (PF00549; HMM-score: 68.3)
    Succ_CoA_lig; Succinyl-CoA ligase like flavodoxin domain (PF13607; HMM-score: 35.2)
    NADP_Rossmann (CL0063) CoA_binding_2; CoA binding domain (PF13380; HMM-score: 22.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:
    SACOL0593(fusA)elongation factor G  [1] (data from MRSA252)
    SACOL0838(gapA1)glyceraldehyde 3-phosphate dehydrogenase  [1] (data from MRSA252)
    SACOL1513(hup)DNA-binding protein HU  [1] (data from MRSA252)
    SACOL1741(icd)isocitrate dehydrogenase  [1] (data from MRSA252)
    SACOL0222(ldh1)L-lactate dehydrogenase  [1] (data from MRSA252)
    SACOL2272(modA)molybdenum ABC transporter molybdenum-binding protein ModA  [1] (data from MRSA252)
    SACOL1102(pdhA)pyruvate dehydrogenase complex E1 component subunit alpha  [1] (data from MRSA252)
    SACOL1103(pdhB)pyruvate dehydrogenase complex E1 component subunit beta  [1] (data from MRSA252)
    SACOL1104(pdhC)branched-chain alpha-keto acid dehydrogenase E2  [1] (data from MRSA252)
    SACOL1105(pdhD)dihydrolipoamide dehydrogenase  [1] (data from MRSA252)
    SACOL2128(pdp)pyrimidine-nucleoside phosphorylase  [1] (data from MRSA252)
    SACOL1745(pyk)pyruvate kinase  [1] (data from MRSA252)
    SACOL2236(rplB)50S ribosomal protein L2  [1] (data from MRSA252)
    SACOL2227(rplE)50S ribosomal protein L5  [1] (data from MRSA252)
    SACOL0585(rplJ)50S ribosomal protein L10  [1] (data from MRSA252)
    SACOL0583(rplK)50S ribosomal protein L11  [1] (data from MRSA252)
    SACOL0586(rplL)50S ribosomal protein L7/L12  [1] (data from MRSA252)
    SACOL2220(rplO)50S ribosomal protein L15  [1] (data from MRSA252)
    SACOL1257(rplS)50S ribosomal protein L19  [1] (data from MRSA252)
    SACOL1702(rplU)50S ribosomal protein L21  [1] (data from MRSA252)
    SACOL1274(rpsB)30S ribosomal protein S2  [1] (data from MRSA252)
    SACOL2233(rpsC)30S ribosomal protein S3  [1] (data from MRSA252)
    SACOL2222(rpsE)30S ribosomal protein S5  [1] (data from MRSA252)
    SACOL2206(rpsI)30S ribosomal protein S9  [1] (data from MRSA252)
    SACOL2215(rpsM)30S ribosomal protein S13  [1] (data from MRSA252)
    SACOL1696(ruvB)Holliday junction DNA helicase RuvB  [1] (data from MRSA252)
    SACOL0095(spa)immunoglobulin G binding protein A precursor  [1] (data from MRSA252)
    SACOL1448(sucB)dihydrolipoamide succinyltransferase  [1] (data from MRSA252)
    SACOL0594(tuf)elongation factor Tu  [1] (data from MRSA252)
    SACOL0944NADH dehydrogenase  [1] (data from MRSA252)
    SACOL0973fumarylacetoacetate hydrolase  [1] (data from MRSA252)
    SACOL2173alkaline shock protein 23  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.173
    • Ymax_pos: 22
    • Cmax: 0.146
    • Cmax_pos: 61
    • Smax: 0.352
    • Smax_pos: 11
    • Smean: 0.242
    • D: 0.2
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MSVFIDKNTKVMVQGITGSTALFHTKQMLDYGTKIVAGVTPGKGGQVVEGVPVFNTVEEAKNETGATVSVIYVPAPFAADSILEAADADLDMVICITEHIPVLDMVKVKRYLQGRKTRLVGPNCPGVITADECKIGIMPGYIHKKGHVGVVSRSGTLTYEAVHQLTEEGIGQTTAVGIGGDPVNGTNFIDVLKAFNEDDETKAVVMIGEIGGTAEEEAAEWIKANMTKPVVGFIGGQTAPPGKRMGHAGAIISGGKGTAEEKIKTLNSCGVKTAATPSEIGSTLIEAAKEAGIYESLLTVNK

Experimental data[edit source | edit]

  • experimentally validated: PeptideAtlas
    experimental localization: Cytoplasmic [2] [3] [4] [5]
    quantitative data / protein copy number per cell: 1012 [6]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)
  2. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  3. Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
    Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
    J. Proteome Res.: 2010, 9(3);1579-90
    [PubMed:20108986] [WorldCat.org] [DOI] (I p)
  4. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J. Proteome Res.: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  5. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  6. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]