From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1812 [new locus tag: SACOL_RS09285 ]
  • pan locus tag?: SAUPAN004448000
  • symbol: rot
  • pan gene symbol?: rot
  • synonym:
  • product: repressor of toxins

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL1812 [new locus tag: SACOL_RS09285 ]
  • symbol: rot
  • product: repressor of toxins
  • replicon: chromosome
  • strand: -
  • coordinates: 1868445..1868945
  • length: 501
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGCATAAGTTAGCACATACAAGTTTTGGGATTGTTGGGATGTTTGTTAATACTTGTATA
    GTAGCTAAATATGTGATTATTAATTGGGAGATGTTTAGCATGAAAAAAGTAAATAACGAC
    ACTGTATTTGGAATTTTGCAATTAGAAACACTTTTGGGTGACATTAACTCAATTTTCAGC
    GAGATTGAAAGCGAATACAAAATGTCTAGAGAAGAAATTTTAATTTTACTAACTTTATGG
    CAAAAAGGTTTTATGACGCTTAAAGAAATGGACAGATTTGTTGAAGTTAAACCGTATAAG
    CGTACGAGAACGTATAATAATTTAGTTGAATTAGAATGGATTTACAAAGAGCGTCCTGTT
    GACGATGAAAGAACAGTTATTATTCATTTCAATGAAAAGTTACAACAAGAGAAAGTAGAG
    TTGTTGAATTTCATCAGTGATGCGATTGCAAGTAGAGCAACAGCAATGCAAAATAGTTTA
    AACGCAATTATTGCTGTGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    501

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL1812 [new locus tag: SACOL_RS09285 ]
  • symbol: Rot
  • description: repressor of toxins
  • length: 166
  • theoretical pI: 5.7418
  • theoretical MW: 19430.5
  • GRAVY: -0.00180723

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Signal transductionRegulatory functionsDNA interactionsstaphylococcal accessory regulator family (TIGR01889; HMM-score: 73.6)
  • TheSEED:  
    Repressor of toxins Rot 
  • PFAM:
    HTH (CL0123) MarR; MarR family (PF01047; HMM-score: 28.4)
    no clan definedDUF2949; Protein of unknown function (DUF2949) (PF11165; HMM-score: 14.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 1.78
    • Cytoplasmic Membrane Score: 8.16
    • Cellwall Score: 0.06
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 4
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.178
    • Ymax_pos: 23
    • Cmax: 0.185
    • Cmax_pos: 23
    • Smax: 0.372
    • Smax_pos: 3
    • Smean: 0.213
    • D: 0.192
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MHKLAHTSFGIVGMFVNTCIVAKYVIINWEMFSMKKVNNDTVFGILQLETLLGDINSIFSEIESEYKMSREEILILLTLWQKGFMTLKEMDRFVEVKPYKRTRTYNNLVELEWIYKERPVDDERTVIIHFNEKLQQEKVELLNFISDAIASRATAMQNSLNAIIAV

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J. Proteome Res.: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]

Stephan Fuchs, Jan Pané-Farré, Christian Kohler, Michael Hecker, Susanne Engelmann
Anaerobic gene expression in Staphylococcus aureus.
J. Bacteriol.: 2007, 189(11);4275-89
[PubMed:17384184] [WorldCat.org] [DOI] (P p)