From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1998 [new locus tag: SACOL_RS10440 ]
  • pan locus tag?: SAUPAN005001000
  • symbol: SACOL1998
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL1998 [new locus tag: SACOL_RS10440 ]
  • symbol: SACOL1998
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2058955..2059131
  • length: 177
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    TTGAAACATCTAACAAAAATATTTGTAGTACTTGCAATTATTTTATTTATTATTGGTTAT
    TATTTACAAGCAACTAATCATGAAAGCCAAGGTATAAAATTATTATTAGCAGCGATTATG
    TTTATGATTTGTGCTTTTATAAGTAGAAGTAATGATCGACGTAAAAATAGTAAATAG
    60
    120
    177

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL1998 [new locus tag: SACOL_RS10440 ]
  • symbol: SACOL1998
  • description: hypothetical protein
  • length: 58
  • theoretical pI: 10.7419
  • theoretical MW: 6685.08
  • GRAVY: 0.551724

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Hypothetical proteinsConservedTIGR00245 family protein (TIGR00245; HMM-score: 18.3)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesoligosaccharide repeat unit polymerase (TIGR04370; HMM-score: 13.4)
  • TheSEED:  
    FIG01107851: hypothetical protein 
  • PFAM:
    no clan definedDUF3169; Protein of unknown function (DUF3169) (PF11368; HMM-score: 22.9)
    DUF1516; Protein of unknown function (DUF1516) (PF07457; HMM-score: 19.4)
    YesK; YesK-like protein (PF14150; HMM-score: 16.8)
    ABC-2 (CL0181) ABC2_membrane_5; ABC-2 family transporter protein (PF13346; HMM-score: 16.5)
    Tetraspannin (CL0347) DUF4064; Protein of unknown function (DUF4064) (PF13273; HMM-score: 15.9)
    no clan definedCyt_c_ox_IV; Cytochrome c oxidase subunit IV (PF12270; HMM-score: 14.2)
    DUF131; Protein of unknown function DUF131 (PF01998; HMM-score: 14)
    P12; Virus attachment protein p12 family (PF12669; HMM-score: 13.6)
    SirB; Invasion gene expression up-regulator, SirB (PF04247; HMM-score: 13.5)
    RseC_MucC; Positive regulator of sigma(E), RseC/MucC (PF04246; HMM-score: 13.2)
    ETRAMP; Malarial early transcribed membrane protein (ETRAMP) (PF09716; HMM-score: 13.2)
    NVEALA; NVEALA protein (PF14055; HMM-score: 12.7)
    E1-E2_ATPase; E1-E2 ATPase (PF00122; HMM-score: 10.2)
    SPC12; Microsomal signal peptidase 12 kDa subunit (SPC12) (PF06645; HMM-score: 9.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.177
    • Ymax_pos: 11
    • Cmax: 0.156
    • Cmax_pos: 25
    • Smax: 0.431
    • Smax_pos: 1
    • Smean: 0.28
    • D: 0.217
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKHLTKIFVVLAIILFIIGYYLQATNHESQGIKLLLAAIMFMICAFISRSNDRRKNSK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]