From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2023 [new locus tag: SACOL_RS10565 ]
  • pan locus tag?: SAUPAN005275000
  • symbol: agrB
  • pan gene symbol?: agrB
  • synonym:
  • product: accessory gene regulator protein B

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL2023 [new locus tag: SACOL_RS10565 ]
  • symbol: agrB
  • product: accessory gene regulator protein B
  • replicon: chromosome
  • strand: +
  • coordinates: 2083138..2083707
  • length: 570
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    TTGAATTATTTTGATAATAAAATTGACCAGTTTGCCACGTATCTTCAAAAGAGAAATAAC
    TTAGATCATATTCAATTTTTGCAAGTACGATTAGGGATGCAGGTCTTAGCTAAAAATATA
    GGTAAATTAATTGTTATGTATACTATTGCCTATATTTTAAACATTTTTCTGTTTACGTTA
    ATTACGAATTTAACATTTTATTTAATAAGAAGACATGCACATGGTGCACATGCACCTTCT
    TCTTTTTGGTGTTATGTAGAAAGTATTATACTATTTATACTTTTACCTTTAGTAATAGTA
    AATTTTCATATTAACTTTTTAATTATGATTATTTTAACAGTTATTTCTTTAGGTGTAATC
    TCAGTATATGCTCCTGCAGCAACTAAAAAGAAGCCCATTCCTGTGCGACTTATTAAACGA
    AAAAAATATTATGCGATTATTGTTAGTTTAACCCTTTTCATTATCACACTTATCATCAAA
    GAGCCATTTGCCCAATTCATTCAATTAGGCATCATAATAGAAGCTATTACATTATTACCT
    ATTTTCTTTATTAAGGAGGACTTAAAATGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    570

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL2023 [new locus tag: SACOL_RS10565 ]
  • symbol: AgrB
  • description: accessory gene regulator protein B
  • length: 189
  • theoretical pI: 10.3336
  • theoretical MW: 21929.5
  • GRAVY: 0.827513

Function[edit source | edit]

  • reaction:
    EC 3.4.-.-?  ExPASy
  • TIGRFAM:
    cxxc_20_cxxc protein (TIGR04104; HMM-score: 6.7)
  • TheSEED:  
    Accessory gene regulator B 
  • PFAM:
    no clan definedAgrB; Accessory gene regulator B (PF04647; HMM-score: 114.5)
    DUF4400; Domain of unknown function (DUF4400) (PF14348; HMM-score: 12.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 5
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 0
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.081
    • Ymax_pos: 15
    • Cmax: 0.107
    • Cmax_pos: 38
    • Smax: 0.108
    • Smax_pos: 6
    • Smean: 0.065
    • D: 0.075
  • predicted transmembrane helices (TMHMM): 5

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNYFDNKIDQFATYLQKRNNLDHIQFLQVRLGMQVLAKNIGKLIVMYTIAYILNIFLFTLITNLTFYLIRRHAHGAHAPSSFWCYVESIILFILLPLVIVNFHINFLIMIILTVISLGVISVYAPAATKKKPIPVRLIKRKKYYAIIVSLTLFIITLIIKEPFAQFIQLGIIIEAITLLPIFFIKEDLK

Experimental data[edit source | edit]

  • experimental localization: Integral membrane [1]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: CodY
    CodY (TF) important in Amino acid metabolismRegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]