From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2044 [new locus tag: SACOL_RS10675 ]
  • pan locus tag?: SAUPAN005305000
  • symbol: SACOL2044
  • pan gene symbol?: ilvH
  • synonym:
  • product: acetolactate synthase 1 regulatory subunit

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL2044 [new locus tag: SACOL_RS10675 ]
  • symbol: SACOL2044
  • product: acetolactate synthase 1 regulatory subunit
  • replicon: chromosome
  • strand: +
  • coordinates: 2104554..2104808
  • length: 255
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    ATGACAAGAATTCTTAAATTACAAGTTGCGGATCAAGTCAGCACGCTAAATCGAATTACA
    AGTGCTTTTGTTCGCCTACAATATAATATCGATACATTACATGTTACACATTCTGAACAA
    CCTGGGATTTCTAACATGGAAATTCAAGTCGATATTCAAGATGATACATCACTTCATATA
    TTAATTAAAAAATTAAAACAACAAATTAATGTTTTAACGGTTGAATGCTACGACCTTGTT
    GATAACGAAGCTTAA
    60
    120
    180
    240
    255

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL2044 [new locus tag: SACOL_RS10675 ]
  • symbol: SACOL2044
  • description: acetolactate synthase 1 regulatory subunit
  • length: 84
  • theoretical pI: 4.96128
  • theoretical MW: 9620.96
  • GRAVY: -0.114286

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismAmino acid biosynthesisPyruvate familyacetolactate synthase, small subunit (TIGR00119; EC 2.2.1.6; HMM-score: 48)
    Cellular processesCellular processesAdaptations to atypical conditionsRelA/SpoT family protein (TIGR00691; HMM-score: 19.3)
    MetabolismAmino acid biosynthesisSerine familyphosphoglycerate dehydrogenase (TIGR01327; EC 1.1.1.95; HMM-score: 14.2)
    MetabolismEnergy metabolismAmino acids and aminesL-serine dehydratase, iron-sulfur-dependent, beta subunit (TIGR00719; EC 4.3.1.17; HMM-score: 12.9)
    MetabolismEnergy metabolismGlycolysis/gluconeogenesisL-serine dehydratase, iron-sulfur-dependent, beta subunit (TIGR00719; EC 4.3.1.17; HMM-score: 12.9)
  • TheSEED:  
    Amino Acids and DerivativesBranched-chain amino acidsBranched-Chain Amino Acid Biosynthesis Acetolactate synthase small subunit (EC 2.2.1.6) 
    CarbohydratesFermentationAcetoin, butanediol metabolism Acetolactate synthase small subunit (EC 2.2.1.6) 
  • PFAM:
    ACT (CL0070) ACT_4; ACT domain (PF13291; HMM-score: 30.9)
    ACT_5; ACT domain (PF13710; HMM-score: 28.7)
    ACT; ACT domain (PF01842; HMM-score: 25.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.155
    • Ymax_pos: 13
    • Cmax: 0.109
    • Cmax_pos: 23
    • Smax: 0.311
    • Smax_pos: 7
    • Smean: 0.243
    • D: 0.189
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MTRILKLQVADQVSTLNRITSAFVRLQYNIDTLHVTHSEQPGISNMEIQVDIQDDTSLHILIKKLKQQINVLTVECYDLVDNEA

Experimental data[edit source | edit]

  • experimentally validated: PeptideAtlas
    experimental localization: Cytoplasmic [1] [2]
    quantitative data / protein copy number per cell: 3810 [3]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: CodY
    CodY (TF) important in Amino acid metabolism  RegPrecise    transcription unit transferred from N315 data RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  3. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]