From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2045 [new locus tag: SACOL_RS10680 ]
  • pan locus tag?: SAUPAN005306000
  • symbol: ilvC
  • pan gene symbol?: ilvC
  • synonym:
  • product: ketol-acid reductoisomerase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL2045 [new locus tag: SACOL_RS10680 ]
  • symbol: ilvC
  • product: ketol-acid reductoisomerase
  • replicon: chromosome
  • strand: +
  • coordinates: 2104945..2105949
  • length: 1005
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    ATGACAACAGTTTATTATGATCAAGATGTAAAAACGGACGCTTTACAAGGCAAAAAAATT
    GCAGTAGTAGGTTATGGATCACAAGGTCACGCGCATGCACAAAACTTAAAAGACAATGGA
    TATGATGTAGTCATCGGCATTCGCCCAGGTCGTTCTTTTGACAAAGCTAAAGAAGATGGA
    TTTGATGTGTTCCCTGTTGCAGAAGCAGTTAAGCAAGCTGATGTAATTATGGTGCTATTA
    CCTGATGAAATTCAAGGTGATGTATACAAAAACGAAATTGAACCAAATTTAGAAAAACAT
    AATGCGCTTGCATTTGCTCATGGCTTTAACATTCATTTTGGTGTTATTCAACCACCAGCT
    GATGTTGATGTATTTTTAGTAGCTCCTAAAGGACCGGGTCATTTAGTTAGACGTACATTT
    GTTGAAGGTTCTGCTGTACCATCACTATTTGGTATTCAACAAGGCGCTTCAGGTCAAGCA
    CGTAATATTGCTTTAAGTTATGCAAAAGGTATTGGTGCAACTCGTGCAGGTGTTATTGAA
    ACAACATTTAAAGAAGAAACTGAGACAGATTTATTTGGTGAACAAGCAGTACTTTGCGGT
    GGTGTATCGAAATTAATTCAAAGTGGCTTTGAAACATTAGTAGAAGCGGGTTATCAACCA
    GAATTAGCTTATTTTGAAGTATTACATGAAATGAAATTAATCGTTGATTTGATGTATGAA
    GGCGGTATGGAAAATGTACGTTACTCAATTTCAAATACTGCTGAATTTGGTGACTATGTT
    TCAGGACCACGTGTTATCACACCAGATGTTAAAGAAAATATGAAAGCTGTATTAACTGAT
    ATCCAAAATGGTAACTTCAGTAATCGCTTTATCGAAGACAATAAAAATGGATTCAAAGAA
    TTTTATAAATTACGCGAAGAACAACATGGTCATCAAATTGAAAAAGTTGGTCGTGAATTA
    CGCGAAATGATGCCTTTTATTAAATCTAAAAGCATTGAAAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1005

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL2045 [new locus tag: SACOL_RS10680 ]
  • symbol: IlvC
  • description: ketol-acid reductoisomerase
  • length: 334
  • theoretical pI: 5.04028
  • theoretical MW: 36955.6
  • GRAVY: -0.29491

Function[edit source | edit]

  • reaction:
    EC 1.1.1.86?  ExPASy
    Ketol-acid reductoisomerase (NADP+)(2R)-2,3-dihydroxy-3-methylbutanoate + NADP+ = (2S)-2-hydroxy-2-methyl-3-oxobutanoate + NADPH(2R,3R)-2,3-dihydroxy-3-methylpentanoate + NADP+ = (S)-2-hydroxy-2-ethyl-3-oxobutanoate + NADPH
  • TIGRFAM:
    MetabolismAmino acid biosynthesisPyruvate familyketol-acid reductoisomerase (TIGR00465; EC 1.1.1.86; HMM-score: 436.7)
    MetabolismEnergy metabolismAmino acids and aminesadenosylhomocysteinase (TIGR00936; EC 3.3.1.1; HMM-score: 31.9)
    2-hydroxy-3-oxopropionate reductase (TIGR01505; EC 1.1.1.60; HMM-score: 17.5)
    Cellular processesCellular processesSporulation and germinationdipicolinic acid synthetase, A subunit (TIGR02853; HMM-score: 15.6)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersPantothenate and coenzyme A2-dehydropantoate 2-reductase (TIGR00745; EC 1.1.1.-; HMM-score: 15.3)
    MetabolismEnergy metabolismAmino acids and amines3-hydroxyisobutyrate dehydrogenase (TIGR01692; EC 1.1.1.31; HMM-score: 14.5)
    MetabolismEnergy metabolismPentose phosphate pathway6-phosphogluconate dehydrogenase (decarboxylating) (TIGR00872; EC 1.1.1.44; HMM-score: 12.7)
    glutamate synthase, NADH/NADPH, small subunit (TIGR01317; EC 1.4.1.-; HMM-score: 12.4)
  • TheSEED:  
    Amino Acids and DerivativesBranched-chain amino acidsBranched-Chain Amino Acid Biosynthesis Ketol-acid reductoisomerase (EC 1.1.1.86) 
    Cofactors, Vitamins, Prosthetic Groups, PigmentsCoenzyme ACoenzyme A Biosynthesis Ketol-acid reductoisomerase (EC 1.1.1.86) 
  • PFAM:
    NADP_Rossmann (CL0063) IlvN; Acetohydroxy acid isomeroreductase, NADPH-binding domain (PF07991; HMM-score: 250)
    6PGD_C (CL0106) IlvC; Acetohydroxy acid isomeroreductase, catalytic domain (PF01450; HMM-score: 218.6)
    NADP_Rossmann (CL0063) 2-Hacid_dh_C; D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain (PF02826; HMM-score: 31.6)
    F420_oxidored; NADP oxidoreductase coenzyme F420-dependent (PF03807; HMM-score: 30.6)
    AdoHcyase_NAD; S-adenosyl-L-homocysteine hydrolase, NAD binding domain (PF00670; HMM-score: 27.6)
    NAD_binding_2; NAD binding domain of 6-phosphogluconate dehydrogenase (PF03446; HMM-score: 27.5)
    NAD_Gly3P_dh_N; NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus (PF01210; HMM-score: 18.3)
    CoA_binding; CoA binding domain (PF02629; HMM-score: 16.5)
    ApbA; Ketopantoate reductase PanE/ApbA (PF02558; HMM-score: 15.6)
    CoA_binding_2; CoA binding domain (PF13380; HMM-score: 13.5)
    Chelatase (CL0043) Oxidored_nitro; Nitrogenase component 1 type Oxidoreductase (PF00148; HMM-score: 12.7)
    NADP_Rossmann (CL0063) Shikimate_DH; Shikimate / quinate 5-dehydrogenase (PF01488; HMM-score: 12.7)
    Mur_ligase; Mur ligase family, catalytic domain (PF01225; HMM-score: 12.7)
    NAD_binding_7; Putative NAD(P)-binding (PF13241; HMM-score: 12.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.212
    • Ymax_pos: 34
    • Cmax: 0.236
    • Cmax_pos: 34
    • Smax: 0.291
    • Smax_pos: 30
    • Smean: 0.138
    • D: 0.183
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MTTVYYDQDVKTDALQGKKIAVVGYGSQGHAHAQNLKDNGYDVVIGIRPGRSFDKAKEDGFDVFPVAEAVKQADVIMVLLPDEIQGDVYKNEIEPNLEKHNALAFAHGFNIHFGVIQPPADVDVFLVAPKGPGHLVRRTFVEGSAVPSLFGIQQGASGQARNIALSYAKGIGATRAGVIETTFKEETETDLFGEQAVLCGGVSKLIQSGFETLVEAGYQPELAYFEVLHEMKLIVDLMYEGGMENVRYSISNTAEFGDYVSGPRVITPDVKENMKAVLTDIQNGNFSNRFIEDNKNGFKEFYKLREEQHGHQIEKVGRELREMMPFIKSKSIEK

Experimental data[edit source | edit]

  • experimentally validated: PeptideAtlas
    experimental localization: Cytoplasmic [1] [2] [3] [4] [5]
    quantitative data / protein copy number per cell: 8038 [6]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: CodY
    CodY (TF) important in Amino acid metabolism  RegPrecise    transcription unit transferred from N315 data RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: 45.11 h [7]

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
    Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
    J. Proteome Res.: 2010, 9(3);1579-90
    [PubMed:20108986] [WorldCat.org] [DOI] (I p)
  3. Annette Dreisbach, Kristina Hempel, Girbe Buist, Michael Hecker, Dörte Becher, Jan Maarten van Dijl
    Profiling the surfacome of Staphylococcus aureus.
    Proteomics: 2010, 10(17);3082-96
    [PubMed:20662103] [WorldCat.org] [DOI] (I p)
  4. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J. Proteome Res.: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  5. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  6. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)
  7. Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol. Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]