From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2066 [new locus tag: SACOL_RS10810 ]
  • pan locus tag?: SAUPAN005347000
  • symbol: kdpC
  • pan gene symbol?: kdpC
  • synonym:
  • product: potassium-transporting ATPase subunit C

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL2066 [new locus tag: SACOL_RS10810 ]
  • symbol: kdpC
  • product: potassium-transporting ATPase subunit C
  • replicon: chromosome
  • strand: -
  • coordinates: 2129148..2129708
  • length: 561
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGAATACGATAAGAAATAGTATTTGTTTAACGATAATAACTATGGTATTATGTGGATTT
    TTATTCCCGTTAGCTATCACGTTAATTGGTCAAATATTTTTTTATCAACAAGCAAATGGC
    AGTTTAATTACGTATGACAATCGTATAGTTGGATCAAAATTGATTGGACAGCACTGGACA
    GAGACACGATATTTTCACGGGAGACCGAGTGCAGTTGATTATAATATGAATCCTGAAAAA
    TTATATAAAAACGGCGTATCTTCAGGTGGAAGTAATGAATCGAATGGAAACACCGAATTA
    ATAGCACGCATGAAACATCATGTTAAATTTGGGAATTCAAATGTAACAATAGATGCTGCA
    ACAAGTTCTGAGTCGGGCTTAGATCCGCATATTACGGTCGAAAATGCATTGAAGCAAGCA
    CCTCGTATTGCTGATGCTCGTCATGTATCTACTTCAAGAGTGGCCGACTTGATTCAACAT
    CGTAAGCAGCGTGGTGTGTTAACAAATGATTATGTGAATGTGCTTGAACTAAATATCGCT
    CTTGATAAGATGAAAGATTGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    561

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL2066 [new locus tag: SACOL_RS10810 ]
  • symbol: KdpC
  • description: potassium-transporting ATPase subunit C
  • length: 186
  • theoretical pI: 9.07581
  • theoretical MW: 20690.4
  • GRAVY: -0.242473

Function[edit source | edit]

  • reaction:
    EC 3.6.3.12?  ExPASy
    Potassium-transporting ATPaseATP + H2O + K+(Out) = ADP + phosphate + K+(In)
  • TIGRFAM:
    MetabolismTransport and binding proteinsCations and iron carrying compoundsK+-transporting ATPase, C subunit (TIGR00681; EC 3.6.3.12; HMM-score: 164.3)
  • TheSEED:  
    Potassium metabolismPotassium metabolism - no subcategoryPotassium homeostasis Potassium-transporting ATPase C chain (EC 3.6.3.12) (TC 3.A.3.7.1) 
  • PFAM:
    no clan definedKdpC; K+-transporting ATPase, c chain (PF02669; HMM-score: 189.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 9.68
    • Cellwall Score: 0.17
    • Extracellular Score: 0.16
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: 0
    • N-terminally Anchored Score: 4
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.218
    • Ymax_pos: 13
    • Cmax: 0.122
    • Cmax_pos: 41
    • Smax: 0.636
    • Smax_pos: 7
    • Smean: 0.483
    • D: 0.322
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNTIRNSICLTIITMVLCGFLFPLAITLIGQIFFYQQANGSLITYDNRIVGSKLIGQHWTETRYFHGRPSAVDYNMNPEKLYKNGVSSGGSNESNGNTELIARMKHHVKFGNSNVTIDAATSSESGLDPHITVENALKQAPRIADARHVSTSRVADLIQHRKQRGVLTNDYVNVLELNIALDKMKD

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]