From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2303 [new locus tag: SACOL_RS12115 ]
  • pan locus tag?: SAUPAN005789000
  • symbol: SACOL2303
  • pan gene symbol?:
  • synonym:
  • product: inositol monophosphatase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL2303 [new locus tag: SACOL_RS12115 ]
  • symbol: SACOL2303
  • product: inositol monophosphatase
  • replicon: chromosome
  • strand: -
  • coordinates: 2365762..2366559
  • length: 798
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGACAGATAAAACATTACAGCAAATAGATAAGTTAATATGTTCGTGGTTGAAACAAATA
    GACAATGTTATTCCGCAATTAATTATGGAAATGACTACAGAAACTAAGCGTCATCGATTT
    GATTTAGTTACAAATGTAGATAAACAGATTCAACAACAATTCCAACAATTTTTAGCAACA
    CATTTTCCGGAACACCAACTATTAGCGGAAGAAAAAAGTAATGAAATGATTACGAATGAA
    ATTAATCATTTATGGATTATGGATCCCATTGATGGAACTGCCAATTTAGTAAAACAGCAA
    GAAGATTATTGTATTATATTGGCGTATTTTTATGAAGGTAAACCAATGTTATCGTACGTA
    TATGATTATCCGCATAAAAAGCTTTATAAAGCAATACGAGGAGAAGGTGCTTTTTGTAAT
    GGAATTAAGATGGAAGAACCACCATCGTTAAAATTGGAAGACGCTATTATATCGTTTAAT
    GCACAAGTGATGAATCTAGATACGGTGCAAGATTTATTTGACGCCTCATTTAGTTATCGT
    TTAGTTGGTGCTTGCGGATTAGATTCTATGCGAGTGGCAAAAGGTCAATTTGGGGCACAT
    ATTAATACAAATCCTAAACCTTGGGACATTGCTGCACAGTTTTTATTTGCAGAACTATTG
    AATCTAAAAATGACGACTTTAGATGGTAAGGCAATTGATCATTTAAAGGGTGCACCTTTT
    ATTATAAGTAATAAAGCATGTCATGAAACGGTACTTAAAATTTTAAATGCAAATGGTGGT
    TATCAAAAATACAGATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    798

Protein[edit source | edit]

Protein Data Bank: 5EYG
Protein Data Bank: 5EYH
Protein Data Bank: 5F24

General[edit source | edit]

  • locus tag: SACOL2303 [new locus tag: SACOL_RS12115 ]
  • symbol: SACOL2303
  • description: inositol monophosphatase
  • length: 265
  • theoretical pI: 6.30614
  • theoretical MW: 30384.9
  • GRAVY: -0.264906

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismAmino acid biosynthesisHistidine familyhistidinol-phosphatase (TIGR02067; EC 3.1.3.15; HMM-score: 89.8)
    MetabolismCentral intermediary metabolismSulfur metabolism3'(2'),5'-bisphosphate nucleotidase (TIGR01331; EC 3.1.3.7; HMM-score: 57.8)
    3'(2'),5'-bisphosphate nucleotidase (TIGR01330; EC 3.1.3.7; HMM-score: 24.4)
    TIGR03545 family protein (TIGR03545; HMM-score: 11.2)
  • TheSEED:  
    Inositol monophosphatase family protein 
  • PFAM:
    Phospoesterase (CL0171) Inositol_P; Inositol monophosphatase family (PF00459; HMM-score: 125.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.101
    • Ymax_pos: 40
    • Cmax: 0.107
    • Cmax_pos: 40
    • Smax: 0.145
    • Smax_pos: 35
    • Smean: 0.091
    • D: 0.097
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MTDKTLQQIDKLICSWLKQIDNVIPQLIMEMTTETKRHRFDLVTNVDKQIQQQFQQFLATHFPEHQLLAEEKSNEMITNEINHLWIMDPIDGTANLVKQQEDYCIILAYFYEGKPMLSYVYDYPHKKLYKAIRGEGAFCNGIKMEEPPSLKLEDAIISFNAQVMNLDTVQDLFDASFSYRLVGACGLDSMRVAKGQFGAHINTNPKPWDIAAQFLFAELLNLKMTTLDGKAIDHLKGAPFIISNKACHETVLKILNANGGYQKYR

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor: RpoF (SigB*) [3] other strains
    RpoF  (SigB*) (sigma factor) controls a large regulon involved in stress/starvation response and adaptation
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]