From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2348 [new locus tag: SACOL_RS12330 ]
  • pan locus tag?: SAUPAN005853000
  • symbol: SACOL2348
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL2348 [new locus tag: SACOL_RS12330 ]
  • symbol: SACOL2348
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2408130..2408777
  • length: 648
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGAAAAAGATGATATTAATTAATGTCATTACGGTTGTTGTACTGTTAGCAATTGGGATT
    GCTGGCTTTTATTTTTGGAATAAAACAACAAGCTATGTAACAACTGATAATGCAAAAGTA
    AATGGCGATCAAATTAAAATAGCAAGTCCTGCATCTGGACAAATTAAATCACTTAATGTT
    AAACAAGGTGACAAACTCGATAAAGGTGACAAAGTAGCAATTGTTACTGTACAAGGTCAA
    GATGGCGAAACGAAAGATATGGATCTTAAAATGCCTCAAAAAGGTACAATTGCCAAATTA
    GATGGTATGGAAGGTTCAATGGTGCAAGCTGGTAACCCAATCGCTTATGCATACAATTTA
    GATGATTTATATGTAACAGCAAATATTGACGAAAAAGATATTAAAGATGTTGAAGTAGGT
    AAAGATGTTGATGTGACTATTGACGGTCAAAAAGCTTCTATTAAAGGTAAAGTTGATAGT
    ATTGGAAAAGCAACTGCTGCAAGCTTTTCATTAATGCCATCATCAAATAGTGATGGTAAC
    TACACTAAAGTTTCTCAAGTAATACCTGTTAAAATCACTCTAGAATCAGAACCGTCTAAA
    CAAGTTGTTCCTGGAATGAACGCTGAAGTAAAAATCCATAAAAATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    648

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL2348 [new locus tag: SACOL_RS12330 ]
  • symbol: SACOL2348
  • description: hypothetical protein
  • length: 215
  • theoretical pI: 7.49286
  • theoretical MW: 23024.3
  • GRAVY: -0.206977

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsOtherefflux pump membrane protein (TIGR00998; HMM-score: 126.2)
    MetabolismTransport and binding proteinsUnknown substrateefflux transporter, RND family, MFP subunit (TIGR01730; HMM-score: 45.5)
    ABC exporter membrane fusion protein, DevB family (TIGR02971; HMM-score: 44.2)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype I secretion membrane fusion protein, HlyD family (TIGR01843; HMM-score: 39.3)
    MetabolismTransport and binding proteinsOthermembrane fusion protein cluster 2 protein (TIGR00999; HMM-score: 31.5)
    MetabolismCentral intermediary metabolismNitrogen metabolismurea carboxylase (TIGR02712; EC 6.3.4.6; HMM-score: 24.2)
    Cellular processesCellular processesBiosynthesis of natural productsNHLM bacteriocin system secretion protein (TIGR03794; HMM-score: 24.1)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesNHLM bacteriocin system secretion protein (TIGR03794; HMM-score: 24.1)
    MetabolismEnergy metabolismGlycolysis/gluconeogenesispyruvate carboxylase (TIGR01235; EC 6.4.1.1; HMM-score: 17.8)
    MetabolismEnergy metabolismPyruvate dehydrogenasedihydrolipoyllysine-residue acetyltransferase (TIGR01348; EC 2.3.1.12; HMM-score: 17.4)
    MetabolismTransport and binding proteinsCations and iron carrying compoundsoxaloacetate decarboxylase alpha subunit (TIGR01108; EC 4.1.1.3; HMM-score: 14.6)
    MetabolismEnergy metabolismOtheroxaloacetate decarboxylase alpha subunit (TIGR01108; EC 4.1.1.3; HMM-score: 14.6)
    MetabolismEnergy metabolismTCA cycledihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex (TIGR01347; EC 2.3.1.61; HMM-score: 14)
  • TheSEED:  
    Virulence, Disease and DefenseResistance to antibiotics and toxic compoundsMultidrug Resistance, 2-protein version Found in Gram-positive bacteria Multidrug resistance protein [function not yet clear] 
  • PFAM:
    Hybrid (CL0105) HlyD_3; HlyD family secretion protein (PF13437; HMM-score: 61.3)
    HlyD_D23; Barrel-sandwich domain of CusB or HlyD membrane-fusion (PF16576; HMM-score: 54.6)
    Biotin_lipoyl_2; Biotin-lipoyl like (PF13533; HMM-score: 37.5)
    Biotin_lipoyl; Biotin-requiring enzyme (PF00364; HMM-score: 36.5)
    HlyD; HlyD membrane-fusion protein of T1SS (PF00529; HMM-score: 16.7)
    DUF2118; Uncharacterized protein conserved in archaea (DUF2118) (PF09891; HMM-score: 15.3)
    no clan definedPASTA; PASTA domain (PF03793; HMM-score: 14.1)
    Hybrid (CL0105) Peptidase_M23; Peptidase family M23 (PF01551; HMM-score: 13.1)
    LysM (CL0187) OapA; Opacity-associated protein A LysM-like domain (PF04225; HMM-score: 11.6)
    DRMIP-like (CL0538) DUF4448; Protein of unknown function (DUF4448) (PF14610; HMM-score: 9.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.17
    • Cytoplasmic Membrane Score: 9.51
    • Cellwall Score: 0.16
    • Extracellular Score: 0.15
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -0.5
    • N-terminally Anchored Score: 4
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.263
    • Ymax_pos: 11
    • Cmax: 0.221
    • Cmax_pos: 34
    • Smax: 0.766
    • Smax_pos: 5
    • Smean: 0.713
    • D: 0.439
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKKMILINVITVVVLLAIGIAGFYFWNKTTSYVTTDNAKVNGDQIKIASPASGQIKSLNVKQGDKLDKGDKVAIVTVQGQDGETKDMDLKMPQKGTIAKLDGMEGSMVQAGNPIAYAYNLDDLYVTANIDEKDIKDVEVGKDVDVTIDGQKASIKGKVDSIGKATAASFSLMPSSNSDGNYTKVSQVIPVKITLESEPSKQVVPGMNAEVKIHKN

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
    Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
    J. Proteome Res.: 2010, 9(3);1579-90
    [PubMed:20108986] [WorldCat.org] [DOI] (I p)
  3. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]