From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2400 [new locus tag: SACOL_RS12590 ]
  • pan locus tag?: SAUPAN005934000
  • symbol: SACOL2400
  • pan gene symbol?:
  • synonym:
  • product: acetyltransferase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL2400 [new locus tag: SACOL_RS12590 ]
  • symbol: SACOL2400
  • product: acetyltransferase
  • replicon: chromosome
  • strand: -
  • coordinates: 2461942..2462478
  • length: 537
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGACAAAAACGATGATTCGACTCGCAAGTGAACAAGATGCAGAAAAATTGCAACAACTC
    ATGCATGAAGCATTTACGCCTCTAAGAGAACTAGGTATTGATTGGCCTTCGGTTAATGCT
    AATTTAGATGCTGTTAAAGAAAATATAGATAAAAATACTACATTTGTCATGACAATTGAT
    GATGAAATTATATCTACGATTACGGTTAGATATCCTTGGGGAAGTGTGAAAAGTATTTCG
    GGTTATCCTTTTGTCTGGTGGTTTGCGACAAATCCTGAGTATGAAGGGAAAGGCTATGGT
    AGCCAATTACTTACTTATGTTGAAGAAGCATTTTTGCGAGATACGTTAAAGTCAGCGGCA
    GTTACTTTAGGTACATCTGCAAGATTGCATCCGTGGTTACTTAAAATTTATGAAAAAAGA
    GGTTATGAAATATACAGCGAACATGAAAATGATGATGGCGATTTAGGTGTGATCATGCGC
    AAAGTATTGATACCCGAGCGCTTTGACGAAACAATATTAGGCCAACCACCATTTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    537

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL2400 [new locus tag: SACOL_RS12590 ]
  • symbol: SACOL2400
  • description: acetyltransferase
  • length: 178
  • theoretical pI: 4.57447
  • theoretical MW: 20425.1
  • GRAVY: -0.319663

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal-protein-alanine acetyltransferase (TIGR01575; EC 2.3.1.128; HMM-score: 12.3)
    putative beta-lysine N-acetyltransferase (TIGR03827; EC 2.3.1.-; HMM-score: 11.9)
  • TheSEED:  
    Uncharacterized N-acetyltransferase YtmI 
  • PFAM:
    Acetyltrans (CL0257) Acetyltransf_1; Acetyltransferase (GNAT) family (PF00583; HMM-score: 34.9)
    Acetyltransf_7; Acetyltransferase (GNAT) domain (PF13508; HMM-score: 34.9)
    Acetyltransf_10; Acetyltransferase (GNAT) domain (PF13673; HMM-score: 34.2)
    Acetyltransf_9; Acetyltransferase (GNAT) domain (PF13527; HMM-score: 26.1)
    GNAT_acetyltr_2; GNAT acetyltransferase 2 (PF13718; HMM-score: 12.9)
    Acetyltransf_4; Acetyltransferase (GNAT) domain (PF13420; HMM-score: 12.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.108
    • Ymax_pos: 18
    • Cmax: 0.108
    • Cmax_pos: 43
    • Smax: 0.135
    • Smax_pos: 10
    • Smean: 0.113
    • D: 0.11
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MTKTMIRLASEQDAEKLQQLMHEAFTPLRELGIDWPSVNANLDAVKENIDKNTTFVMTIDDEIISTITVRYPWGSVKSISGYPFVWWFATNPEYEGKGYGSQLLTYVEEAFLRDTLKSAAVTLGTSARLHPWLLKIYEKRGYEIYSEHENDDGDLGVIMRKVLIPERFDETILGQPPF

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]