From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2519 [new locus tag: SACOL_RS13190 ]
  • pan locus tag?: SAUPAN006136000
  • symbol: SACOL2519
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL2519 [new locus tag: SACOL_RS13190 ]
  • symbol: SACOL2519
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2578702..2579190
  • length: 489
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    GTGTTTAATATGTTTCATTTTATAATTATGGTGGTATATAACATGAATTATAACATATTG
    GAGGTTAAGGAAATGCCCTTTACAATGAAAGGTTACCCCGAAAAATGGAAAGAATTTGAA
    GTAATTAAACGGCAAAAAGCGATAGAAATTGCGAATGCAATGTTAAAAGAAGGATATCTT
    GAAAAAGATGTTGTTCCTATTGCGGCGAAAAAAGCGAAAGATTGGTATCGAGCGTTATCG
    AAAGAAGAAATCAAAGCATTAGAAGAAGAGAACTTCGTACAATTCCATACAGCAACAATG
    GAAAAAACAGAGGTGGATAGTGAATATGCAACAACTGATAATGAAGAACATATTCAAGAA
    CAATCAAATCAAGATAAATCGTACTTTGATAGCGAATCAATTGGCAACCAAAGTGGTGGC
    GTTCGACAAAGAGAACCGCTTATGGATGGTCCACATCCAAAAGTTGTGGAATCATTTAAA
    GACGTATAA
    60
    120
    180
    240
    300
    360
    420
    480
    489

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL2519 [new locus tag: SACOL_RS13190 ]
  • symbol: SACOL2519
  • description: hypothetical protein
  • length: 162
  • theoretical pI: 4.75102
  • theoretical MW: 19014.5
  • GRAVY: -0.698148

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    FIG01108416: hypothetical protein 
  • PFAM:
    HTH (CL0123) DEP; Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP) (PF00610; HMM-score: 14.5)
    no clan definedPhg_2220_C; Conserved phage C-terminus (Phg_2220_C) (PF09524; HMM-score: 12.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.117
    • Ymax_pos: 23
    • Cmax: 0.117
    • Cmax_pos: 23
    • Smax: 0.157
    • Smax_pos: 2
    • Smean: 0.124
    • D: 0.12
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MFNMFHFIIMVVYNMNYNILEVKEMPFTMKGYPEKWKEFEVIKRQKAIEIANAMLKEGYLEKDVVPIAAKKAKDWYRALSKEEIKALEEENFVQFHTATMEKTEVDSEYATTDNEEHIQEQSNQDKSYFDSESIGNQSGGVRQREPLMDGPHPKVVESFKDV

Experimental data[edit source | edit]

  • experimentally validated: PeptideAtlas
    experimental localization: Cytoplasmic [1] [2] [3]
    quantitative data / protein copy number per cell: 2506 [4]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor: RpoF (SigB*) [5] other strains
    RpoF  (SigB*) (sigma factor) controls a large regulon involved in stress/starvation response and adaptation
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: 6.13 h [6]

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]