NCBI: 10-JUN-2013
Contents
⊟Summary[edit source | edit]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2595
- pan locus tag?: SAUPAN006254000
- symbol: SACOL2595
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit source | edit]
⊟Gene[edit source | edit]
⊟General[edit source | edit]
- type: CDS
- locus tag: SACOL2595
- symbol: SACOL2595
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 2656321..2656428
- length: 108
- essential: unknown
⊟Accession numbers[edit source | edit]
- Gene ID: 3237202 NCBI
- RefSeq: YP_187386 NCBI
- MicrobesOnline: 914065 MicrobesOnline
⊟Phenotype[edit source | edit]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit source | edit]
- 1
61ATGTTACAAACATTGAAATTAGAGGTATATAAAAAATGCTTCTGCAATAGATGCAATAAA
CATGCAATACAATATGGAGGCGAAGTAAATGAAAAGTATTACGTTTGA60
108
⊟Protein[edit source | edit]
⊟General[edit source | edit]
- locus tag: SACOL2595
- symbol: SACOL2595
- description: hypothetical protein
- length: 35
- theoretical pI: 8.85845
- theoretical MW: 4214.93
- GRAVY: -0.554286
⊟Function[edit source | edit]
- TIGRFAM:
- TheSEED:
- PFAM: TIM_barrel (CL0036) TIM; Triosephosphate isomerase (PF00121; HMM-score: 12.2)
⊟Structure, modifications & interactions[edit source | edit]
- domains:
- modifications:
- cofactors:
- effectors:
- protein partners:
⊟Localization[edit source | edit]
- PSORTb: Extracellular
- Cytoplasmic Score: 0.24
- Cytoplasmic Membrane Score: 0.05
- Cellwall Score: 0.8
- Extracellular Score: 8.91
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular Possibility: 1
- Signal Peptide Possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- Ymax: 0.185
- Ymax_pos: 11
- Cmax: 0.128
- Cmax_pos: 23
- Smax: 0.406
- Smax_pos: 7
- Smean: 0.351
- D: 0.25
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit source | edit]
⊟Protein sequence[edit source | edit]
- MLQTLKLEVYKKCFCNRCNKHAIQYGGEVNEKYYV
⊟Experimental data[edit source | edit]
- experimental localization: Cytoplasmic [1]
⊟Expression & Regulation[edit source | edit]
⊟Operon[edit source | edit]
⊟Regulation[edit source | edit]
- sigma factor:
- regulator:
⊟Transcription pattern[edit source | edit]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit source | edit]
- Aureolib: no data available
⊟Protein stability[edit source | edit]
- half-life: no data available
⊟Biological Material[edit source | edit]
⊟Mutants[edit source | edit]
⊟Expression vector[edit source | edit]
⊟lacZ fusion[edit source | edit]
⊟GFP fusion[edit source | edit]
⊟two-hybrid system[edit source | edit]
⊟FLAG-tag construct[edit source | edit]
⊟Antibody[edit source | edit]
⊟Other Information[edit source | edit]
You are kindly invited to share additional interesting facts.
⊟Literature[edit source | edit]
⊟References[edit source | edit]
- ↑
Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS ONE: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e)
⊟Relevant publications[edit source | edit]
