From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2670 [new locus tag: SACOL_RS13985 ]
  • pan locus tag?: SAUPAN006381000
  • symbol: SACOL2670
  • pan gene symbol?: gtfA
  • synonym:
  • product: glycosyl transferase, group 1 family protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL2670 [new locus tag: SACOL_RS13985 ]
  • symbol: SACOL2670
  • product: glycosyl transferase, group 1 family protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2738799..2740307
  • length: 1509
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    1201
    1261
    1321
    1381
    1441
    1501
    ATGACAATATATAATATAAACTTTGGTATAGGCTGGGCGAGTAGCGGTGTTGAATATGCA
    CAAGCTTACCGTGCTAAATTATTGAGACGTACAAATCAAGACACTAAATTTGTGTTTTTA
    GATTTTATACAGTCAGAGAACATACAGACATTAACGCAAAACATTGGGTTTAAAGATCAA
    GAAGTTATTTGGTTGTATCAGTATTTTAGTGATATTTCTTTAGCACCAACAACGTACACG
    TTAGATGACATTGAACGTGAGCTTGGTCATGACATTAGTTTTAGAGAAAGAAATGGTAAG
    ATAGTCCGCCTATATTTTAATGGGAAATCATCATTTGTAACATGTTATCTGCAAAATGAA
    CAAAAAGATATTGTGGATCGTGCAGAATTTGTAATTAATAGTATGTTAGTACGTAAAGAT
    TTTTATAGTTATACGCGCATATTTTCTGAGTATTATGCACCAGCTGATAATAAAGCGAAA
    TTATATATGCGACAATTTTATAATCAAGATGGTTCCATCGCTTATAACGAATATATTGAT
    GGAGACAGCTCTATATATGTGTTTGAAGATGCGGTGTTGTATAACAAAACGGAATTTATT
    GCATACTTTTTACAACGATTGAATTTAACCCGAGACGATATTGTCATATTAGACCGCGCT
    TCTGATATTGGTCAGGCTGTTTTGCAGCATAAAGGTGATAGTAAAGTTGGTGTTGTGATT
    CATGCTGATCATTATAGTAATAATATGATGAGTGAGCAGCATATACTATGGAACAATTAT
    TATGAATATCAATTTTCAAAAGCTAAATACATTGATTTCTTTATTACAGCAACAGATATT
    CAAAATCATATGGTTTGTCGACAATTTGAGCAATATCAAGGTTATCGCCCACGTGTTTAT
    ACTATTCCTGTGGGAAGCATTGATGCATTATCATATCCAACATTATCAAGAAAGCCATAT
    GCGATGATTAGTGCATCTCGTTTAGCGAATGAGAAACATATTGATTGGCTTGTCAAAGCG
    GTTATCGTGGCTAAACGACAAGTGCCAGAATTAACATTTGATATTTATGGAGAAGGTAGC
    GAGAAGACGCGACTGCGTAAAATTATTGATACACACCGCGCACAAGATTATATTCGTTTA
    CTAGGGCATGTTAAACTTGATGAAATTTATAATGATTATGAGTTATTTCTTTCTGCATCA
    ACTAGCGAAGGTTTTGGGTTAACACTAATGGAAGCGGTAGGCTCAGGACTAGGTATGATT
    GGATTAAATGTGAATTATGGTAACCCAACCTTTATTCGAGATGGGGAAAATGGCTACTTG
    GTACCTTTTGATACCGACGAAGATAGTGTGGATGATGTTATCGCAAAACTAGCTCATGCC
    ATTGTAATGTATTTTAACAATGGTCCCCAGACACCACATGACATCTCTTATGAAGTGGCA
    CAGCAATTTATGACTCAAGATATTATTTTAAAATGGGAAACATTAGTTCAAGAGGTGCTA
    CATGATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1200
    1260
    1320
    1380
    1440
    1500
    1509

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL2670 [new locus tag: SACOL_RS13985 ]
  • symbol: SACOL2670
  • description: glycosyl transferase, group 1 family protein
  • length: 502
  • theoretical pI: 4.90817
  • theoretical MW: 58272.2
  • GRAVY: -0.311753

Function[edit source | edit]

  • reaction:
    EC 2.4.1.-?  ExPASy
  • TIGRFAM:
    Genetic information processingProtein fateProtein modification and repairaccessory Sec system glycosylation protein GtfA (TIGR02918; EC 2.4.1.-; HMM-score: 867)
    sugar transferase, PEP-CTERM/EpsH1 system associated (TIGR03088; HMM-score: 55.1)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersGlutathione and analogsN-acetyl-alpha-D-glucosaminyl L-malate synthase BshA (TIGR03999; EC 2.4.1.-; HMM-score: 51.1)
    colanic acid biosynthesis glycosyltransferase WcaL (TIGR04005; EC 2.4.-.-; HMM-score: 36.9)
    MetabolismEnergy metabolismBiosynthesis and degradation of polysaccharidesglycogen synthase, Corynebacterium family (TIGR02149; HMM-score: 21.8)
    glycosyltransferase, GG-Bacteroidales peptide system (TIGR04157; EC 2.4.1.-; HMM-score: 21)
    sucrose-phosphate synthase, putative, glycosyltransferase domain (TIGR02472; EC 2.4.1.14; HMM-score: 19)
    D-inositol-3-phosphate glycosyltransferase (TIGR03449; EC 2.4.1.250; HMM-score: 18.2)
    PEP-CTERM/exosortase A-associated glycosyltransferase, Daro_2409 family (TIGR04063; EC 2.4.-.-; HMM-score: 16.8)
    Unknown functionEnzymes of unknown specificityglycosyltransferase, MSMEG_0565 family (TIGR04047; HMM-score: 15.3)
    sucrose phosphate synthase (TIGR02468; EC 2.4.1.14; HMM-score: 11.7)
    putative glycosyltransferase, TIGR04348 family (TIGR04348; EC 2.4.1.-; HMM-score: 10.7)
  • TheSEED:  
    Membrane TransportProtein translocation across cytoplasmic membraneSecY2-SecA2 Specialized Transport System Poly(glycerol-phosphate) alpha-glucosyltransferase GftA (EC 2.4.1.52) 
  • PFAM:
    GT-B (CL0113) Glycos_transf_1; Glycosyl transferases group 1 (PF00534; HMM-score: 85.9)
    Glyco_trans_1_4; Glycosyl transferases group 1 (PF13692; HMM-score: 65.6)
    no clan definedDUF5503; Family of unknown function (DUF5503) (PF17607; HMM-score: 15.5)
    GT-B (CL0113) Glyco_trans_1_3; Glycosyl transferase family 1 (PF13528; HMM-score: 13.9)
    no clan definedDUF4304; Domain of unknown function (DUF4304) (PF14137; HMM-score: 13.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 0
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.15
    • Ymax_pos: 23
    • Cmax: 0.281
    • Cmax_pos: 23
    • Smax: 0.159
    • Smax_pos: 19
    • Smean: 0.069
    • D: 0.119
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MTIYNINFGIGWASSGVEYAQAYRAKLLRRTNQDTKFVFLDFIQSENIQTLTQNIGFKDQEVIWLYQYFSDISLAPTTYTLDDIERELGHDISFRERNGKIVRLYFNGKSSFVTCYLQNEQKDIVDRAEFVINSMLVRKDFYSYTRIFSEYYAPADNKAKLYMRQFYNQDGSIAYNEYIDGDSSIYVFEDAVLYNKTEFIAYFLQRLNLTRDDIVILDRASDIGQAVLQHKGDSKVGVVIHADHYSNNMMSEQHILWNNYYEYQFSKAKYIDFFITATDIQNHMVCRQFEQYQGYRPRVYTIPVGSIDALSYPTLSRKPYAMISASRLANEKHIDWLVKAVIVAKRQVPELTFDIYGEGSEKTRLRKIIDTHRAQDYIRLLGHVKLDEIYNDYELFLSASTSEGFGLTLMEAVGSGLGMIGLNVNYGNPTFIRDGENGYLVPFDTDEDSVDDVIAKLAHAIVMYFNNGPQTPHDISYEVAQQFMTQDIILKWETLVQEVLHD

Experimental data[edit source | edit]

  • experimental localization: Cytoplasmic [1]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor: RpoF (SigB*) [2] [3] other strains
    RpoF  (SigB*) (sigma factor) controls a large regulon involved in stress/starvation response and adaptation
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  2. Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J. Bacteriol.: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)
  3. Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
    The sigmaB regulon in Staphylococcus aureus and its regulation.
    Int. J. Med. Microbiol.: 2006, 296(4-5);237-58
    [PubMed:16644280] [WorldCat.org] [DOI] (P p)

Relevant publications[edit source | edit]