From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS00750 [old locus tag: SACOL0148 ]
  • pan locus tag?: SAUPAN000991000
  • symbol: SACOL_RS00750
  • pan gene symbol?: capM
  • synonym:
  • product: sugar transferase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS00750 [old locus tag: SACOL0148 ]
  • symbol: SACOL_RS00750
  • product: sugar transferase
  • replicon: chromosome
  • strand: +
  • coordinates: 165991..166548
  • length: 558
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (165991..166548) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGAAGCGATTATTCGATGTAGTGAGTTCAATATATGGTTTAGTAGTTTTAAGTCCGATT
    CTGTTAATTACAGCATTACTAATTAAAATGGAATCACCTGGACCAGCCATTTTCAAACAA
    AAAAGACCGACGATTAATAATGAATTGTTTAATATTTATAAGTTTAGATCAATGAAAATA
    GACACACCTAATGTTGCAACTGATTTAATGGATTCAACATCGTATATAACAAAGACAGGG
    AAGGTCATTCGTAAGACCTCTATTGATGAATTGCCACAATTATTGAATGTTTTAAAAGGA
    GAAATGTCAATTGTAGGTCCTAGACCAGCGCTTTATAATCAATACGAATTAATCGAAAAA
    CGTACAAAAGCGAACGTGCATACGATTAGACCAGGTGTGACAGGACTAGCTCAAGTGATG
    GGGAGAGATGATATCACTGATGATCAAAAAGTAGCGTATGATCATTATTACTTAACACAT
    CAATCTATGATGCTTGATATGTATATCATATATAAAACAATTAAAAATATCGTTACTTCA
    GAAGGTGTGCATCACTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    558

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS00750 [old locus tag: SACOL0148 ]
  • symbol: SACOL_RS00750
  • description: sugar transferase
  • length: 185
  • theoretical pI: 9.71543
  • theoretical MW: 21062.6
  • GRAVY: -0.103784

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase (TIGR03025; HMM-score: 245.8)
    undecaprenyl-phosphate glucose phosphotransferase (TIGR03023; EC 2.7.8.-; HMM-score: 219.7)
    undecaprenyl-phosphate galactose phosphotransferase WbaP (TIGR03022; EC 2.7.8.6; HMM-score: 188.4)
    sugar transferase, PEP-CTERM system associated (TIGR03013; HMM-score: 170.9)
  • TheSEED:
  • PFAM:
    no clan definedBac_transf; Bacterial sugar transferase (PF02397; HMM-score: 206)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.01
    • Cytoplasmic Membrane Score: 9.99
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helix: 1
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.247
    • Ymax_pos: 37
    • Cmax: 0.2
    • Cmax_pos: 37
    • Smax: 0.415
    • Smax_pos: 9
    • Smean: 0.308
    • D: 0.271
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

  • GI: 446747842 NCBI
  • RefSeq: WP_000825098 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKRLFDVVSSIYGLVVLSPILLITALLIKMESPGPAIFKQKRPTINNELFNIYKFRSMKIDTPNVATDLMDSTSYITKTGKVIRKTSIDELPQLLNVLKGEMSIVGPRPALYNQYELIEKRTKANVHTIRPGVTGLAQVMGRDDITDDQKVAYDHYYLTHQSMMLDMYIIYKTIKNIVTSEGVHH

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS00750 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]