Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS01680 [old locus tag: SACOL0334 ]
  • pan locus tag?: SAUPAN001434000
  • symbol: SACOL_RS01680
  • pan gene symbol?:
  • synonym:
  • product: DUF1270 domain-containing protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS01680 [old locus tag: SACOL0334 ]
  • symbol: SACOL_RS01680
  • product: DUF1270 domain-containing protein
  • replicon: chromosome
  • strand: +
  • coordinates: 361971..362132
  • length: 162
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (361971..362132) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    ATGAGCGACACATATAAAAGCTACCTAGTAGCAGTACTATGCTTCACAGTCTTAGCAATT
    GTACTTATGCCGTTTCTATACTTCACTACAGCATGGTCAATTGCGGGATTCGCAAGTATC
    GCAACATTCATATTTTATAAAGAATACTTTTATGAAGAATAA
    60
    120
    162

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS01680 [old locus tag: SACOL0334 ]
  • symbol: SACOL_RS01680
  • description: DUF1270 domain-containing protein
  • length: 53
  • theoretical pI: 4.1475
  • theoretical MW: 6187.23
  • GRAVY: 0.967925

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:
  • PFAM:
    no clan definedDUF1270; Protein of unknown function (DUF1270) (PF06900; HMM-score: 131.9)
    EcsB; Bacterial ABC transporter protein EcsB (PF05975; HMM-score: 14.4)
    DUF2244; Integral membrane protein (DUF2244) (PF10003; HMM-score: 13.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.184
    • Ymax_pos: 11
    • Cmax: 0.153
    • Cmax_pos: 38
    • Smax: 0.43
    • Smax_pos: 2
    • Smean: 0.347
    • D: 0.247
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

  • GI: 447208706 NCBI
  • RefSeq: WP_001285962 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MSDTYKSYLVAVLCFTVLAIVLMPFLYFTTAWSIAGFASIATFIFYKEYFYEE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS01680 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]