From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS01990 [old locus tag: SACOL0395 ]
  • pan locus tag?: SAUPAN001856000
  • symbol: SACOL_RS01990
  • pan gene symbol?: gcvH-L
  • synonym:
  • product: glycine cleavage system protein H

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS01990 [old locus tag: SACOL0395 ]
  • symbol: SACOL_RS01990
  • product: glycine cleavage system protein H
  • replicon: chromosome
  • strand: +
  • coordinates: 402086..402418
  • length: 333
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (402086..402418) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    ATGAAAAAGTTAGCCAATTATTTATGGGTAGAAAAAGTAGGAGATTTGTATGTGTTTAGT
    ATGACACCTGAATTGCAAGATGATATTGGGACAGTAGGTTATGTTGAATTCGTAAGTCCA
    GATGAAGTTAAAGTGGATGATGAAATTGTGAGTATCGAAGCATCGAAAACGGTCATTGAT
    GTGCAAACGCCATTGTCAGGAACGATTATTGAGCGAAATACAAAAGCGGAAGAAGAACCG
    ACAATTTTAAACTCTGAAAAACCAGAAGAAAATTGGTTGTTCAAATTGGATGATGTCGAT
    AAAGAAGCATTCCTAGCATTACCGGAGGCTTAA
    60
    120
    180
    240
    300
    333

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS01990 [old locus tag: SACOL0395 ]
  • symbol: SACOL_RS01990
  • description: glycine cleavage system protein H
  • length: 110
  • theoretical pI: 3.86736
  • theoretical MW: 12421.9
  • GRAVY: -0.263636

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismEnergy metabolismAmino acids and aminesglycine cleavage system H protein (TIGR00527; HMM-score: 57.2)
    glycine cleavage protein H-like protein (TIGR03077; HMM-score: 38.6)
    MetabolismEnergy metabolismTCA cycledihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex (TIGR01347; EC 2.3.1.61; HMM-score: 18.3)
    MetabolismCentral intermediary metabolismNitrogen metabolismurea carboxylase (TIGR02712; EC 6.3.4.6; HMM-score: 9.4)
  • TheSEED:
  • PFAM:
    Hybrid (CL0105) GCV_H; Glycine cleavage H-protein (PF01597; HMM-score: 61.4)
    Biotin_lipoyl; Biotin-requiring enzyme (PF00364; HMM-score: 19.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.1
    • Ymax_pos: 28
    • Cmax: 0.139
    • Cmax_pos: 46
    • Smax: 0.119
    • Smax_pos: 26
    • Smean: 0.092
    • D: 0.097
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446654532 NCBI
  • RefSeq: WP_000731878 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKKLANYLWVEKVGDLYVFSMTPELQDDIGTVGYVEFVSPDEVKVDDEIVSIEASKTVIDVQTPLSGTIIERNTKAEEEPTILNSEKPEENWLFKLDDVDKEAFLALPEA

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS01990 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]