From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS02645 [old locus tag: SACOL0522 ]
  • pan locus tag?: SAUPAN002200000
  • symbol: SACOL_RS02645
  • pan gene symbol?: recR
  • synonym:
  • product: recombination protein RecR

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS02645 [old locus tag: SACOL0522 ]
  • symbol: SACOL_RS02645
  • product: recombination protein RecR
  • replicon: chromosome
  • strand: +
  • coordinates: 527697..528293
  • length: 597
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (527697..528293) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGCATTATCCAGAACCTATATCAAAACTTATTGATAGCTTTATGAAATTGCCAGGCATT
    GGTCCAAAGACAGCCCAACGTCTGGCTTTTCATACCTTAGATATGAAAGAAGACGATGTT
    GTTCAGTTTGCCAAAGCATTAGTAGATGTTAAGAGAGAATTAACATATTGTAGCGTATGT
    GGTCACATTACTGAAAATGATCCATGTTATATTTGTGAAGATAAGCAAAGAGATCGTTCA
    GTTATTTGTGTTGTGGAAGATGACAAAGATGTCATAGCTATGGAAAAAATGAGAGAATAC
    AAAGGTTTATATCACGTTTTACATGGGTCTATTTCGCCTATGGATGGCATTGGACCAGAA
    GATATTAATATTCCTTCATTGATTGAACGCTTGAAAAACGATGAAGTTAGCGAATTAATC
    TTAGCTATGAACCCGAACTTAGAGGGGGAATCTACAGCCATGTATATTTCTAGATTAGTT
    AAGCCTATAGGTATCAAAGTGACGAGATTAGCACAAGGGTTATCGGTAGGTGGCGATTTA
    GAGTATGCTGACGAAGTAACATTATCTAAAGCAATCGCAGGTAGAACAGAAATGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    597

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS02645 [old locus tag: SACOL0522 ]
  • symbol: SACOL_RS02645
  • description: recombination protein RecR
  • length: 198
  • theoretical pI: 4.75667
  • theoretical MW: 22099.4
  • GRAVY: -0.191414

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingDNA metabolismDNA replication, recombination, and repairrecombination protein RecR (TIGR00615; HMM-score: 290.7)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairHolliday junction DNA helicase RuvA (TIGR00084; EC 3.6.4.12; HMM-score: 11.4)
  • TheSEED:
  • PFAM:
    Toprim-like (CL0413) Toprim_4; Toprim domain (PF13662; HMM-score: 91.8)
    no clan definedRecR; RecR protein (PF02132; HMM-score: 60)
    Toprim-like (CL0413) Toprim; Toprim domain (PF01751; HMM-score: 36.6)
    HHH (CL0198) HHH; Helix-hairpin-helix motif (PF00633; HMM-score: 22.4)
    HHH_5; Helix-hairpin-helix domain (PF14520; HMM-score: 19.6)
    HHH_8; Helix-hairpin-helix domain (PF14716; HMM-score: 15.1)
    IMS_HHH; IMS family HHH motif (PF11798; HMM-score: 14.1)
    RING (CL0229) Zn_ribbon_17; Zinc-ribbon, C4HC2 type (PF17120; HMM-score: 13.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.151
    • Ymax_pos: 28
    • Cmax: 0.128
    • Cmax_pos: 47
    • Smax: 0.328
    • Smax_pos: 24
    • Smean: 0.164
    • D: 0.156
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446481302 NCBI
  • RefSeq: WP_000559156 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MHYPEPISKLIDSFMKLPGIGPKTAQRLAFHTLDMKEDDVVQFAKALVDVKRELTYCSVCGHITENDPCYICEDKQRDRSVICVVEDDKDVIAMEKMREYKGLYHVLHGSISPMDGIGPEDINIPSLIERLKNDEVSELILAMNPNLEGESTAMYISRLVKPIGIKVTRLAQGLSVGGDLEYADEVTLSKAIAGRTEM

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS02645 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]