From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS04345 [old locus tag: SACOL0845 ]
  • pan locus tag?: SAUPAN002713000
  • symbol: SACOL_RS04345
  • pan gene symbol?: est
  • synonym:
  • product: carboxylesterase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS04345 [old locus tag: SACOL0845 ]
  • symbol: SACOL_RS04345
  • product: carboxylesterase
  • replicon: chromosome
  • strand: +
  • coordinates: 872232..872972
  • length: 741
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (872232..872972) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGCAGATAAAATTACCAAAACCTTTCTTTTTTGAGGAAGGTAAACGTGCCGTGTTATTA
    CTACATGGTTTTACAGGCAATTCGTCTGATGTTCGTCAATTAGGTCGATTTTTACAAAAG
    AAAGGTTATACATCATATGCACCGCAATATGAAGGCCACGCGGCACCACCAGATGAAATA
    CTGAAATCTAGTCCTTTCGTTTGGTTTAAAGATGCGTTAGATGGTTATGATTATCTTGTT
    GAACAAGGTTATGATGAAATTGTTGTTGCTGGTCTATCATTAGGTGGGGATTTTGCTTTA
    AAATTAAGCTTAAATAGAGATGTAAAGGGTATTGTAACGATGTGTGCTCCTATGGGTGGC
    AAAACTGAAGGTGCCATTTATGAAGGCTTTTTAGAATATGCACGCAATTTTAAAAAGTAT
    GAAGGTAAAGATCAAGAGACTATTGATAATGAAATGGATCATTTTAAACCAACTGAAACT
    TTAAAAGAACTAAGTGAAGCATTAGATACGATTAAAGAGCAAGTTGATGAAGTGTTGGAT
    CCTATTTTAGTGATTCAAGCAGAAAACGACAATATGATTGATCCACAATCCGCAAATTAT
    ATATATGACCATGTAGATTCTGATGACAAAAATATCAAGTGGTACAGTGAATCTGGACAT
    GTTATTACGATTGATAAAGAGAAAGAACAAGTATTTGAAGATATTTATCAATTTTTAGAG
    TCATTAGACTGGTCAGAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    741

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS04345 [old locus tag: SACOL0845 ]
  • symbol: SACOL_RS04345
  • description: carboxylesterase
  • length: 246
  • theoretical pI: 4.25813
  • theoretical MW: 28094.2
  • GRAVY: -0.512602

Function[edit source | edit]

  • reaction:
    EC 3.1.1.1?  ExPASy
    CarboxylesteraseA carboxylic ester + H2O = an alcohol + a carboxylate
  • TIGRFAM:
    Plasmodium subtelomeric family (TIGR01607; HMM-score: 29.2)
    MetabolismFatty acid and phospholipid metabolismBiosynthesispoly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit (TIGR01836; HMM-score: 25.1)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersMenaquinone and ubiquinone2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (TIGR03695; EC 4.2.99.20; HMM-score: 22.3)
    MetabolismEnergy metabolismOther3-oxoadipate enol-lactonase (TIGR02427; EC 3.1.1.24; HMM-score: 20.3)
    MetabolismEnergy metabolismPhotosynthesisputative magnesium chelatase accessory protein (TIGR03056; HMM-score: 11)
  • TheSEED:
  • PFAM:
    AB_hydrolase (CL0028) Hydrolase_4; Serine aminopeptidase, S33 (PF12146; HMM-score: 69.8)
    Abhydrolase_1; alpha/beta hydrolase fold (PF00561; HMM-score: 37.5)
    DLH; Dienelactone hydrolase family (PF01738; HMM-score: 35.9)
    Peptidase_S9; Prolyl oligopeptidase family (PF00326; HMM-score: 30.3)
    Abhydrolase_6; Alpha/beta hydrolase family (PF12697; HMM-score: 25.3)
    BAAT_C; BAAT / Acyl-CoA thioester hydrolase C terminal (PF08840; HMM-score: 22.8)
    Abhydrolase_3; alpha/beta hydrolase fold (PF07859; HMM-score: 19.2)
    DUF2048; Abhydrolase domain containing 18 (PF09752; HMM-score: 18.2)
    PhoPQ_related; PhoPQ-activated pathogenicity-related protein (PF10142; HMM-score: 17.7)
    FSH1; Serine hydrolase (FSH1) (PF03959; HMM-score: 16.4)
    no clan definedDUF4611; Domain of unknown function (DUF4611) (PF15387; HMM-score: 15.5)
    LisH (CL0561) LisH; LisH (PF08513; HMM-score: 14.4)
    AB_hydrolase (CL0028) Chlorophyllase2; Chlorophyllase enzyme (PF12740; HMM-score: 13.8)
    Chlorophyllase; Chlorophyllase (PF07224; HMM-score: 12.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.174
    • Ymax_pos: 15
    • Cmax: 0.106
    • Cmax_pos: 38
    • Smax: 0.401
    • Smax_pos: 5
    • Smean: 0.29
    • D: 0.219
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 447088696 NCBI
  • RefSeq: WP_001165952 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MQIKLPKPFFFEEGKRAVLLLHGFTGNSSDVRQLGRFLQKKGYTSYAPQYEGHAAPPDEILKSSPFVWFKDALDGYDYLVEQGYDEIVVAGLSLGGDFALKLSLNRDVKGIVTMCAPMGGKTEGAIYEGFLEYARNFKKYEGKDQETIDNEMDHFKPTETLKELSEALDTIKEQVDEVLDPILVIQAENDNMIDPQSANYIYDHVDSDDKNIKWYSESGHVITIDKEKEQVFEDIYQFLESLDWSE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS04345 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]