From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS04705 [old locus tag: SACOL0917 ]
  • pan locus tag?: SAUPAN002898000
  • symbol: SACOL_RS04705
  • pan gene symbol?: sufU
  • synonym:
  • product: iron-sulfur cluster assembly scaffold protein NifU

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS04705 [old locus tag: SACOL0917 ]
  • symbol: SACOL_RS04705
  • product: iron-sulfur cluster assembly scaffold protein NifU
  • replicon: chromosome
  • strand: +
  • coordinates: 924755..925219
  • length: 465
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (924755..925219) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAATTTTAATAATCTAGATCAATTATATAGATCTGTCATTATGGATCATTATAAAAAT
    CCTAGAAATAAAGGTGTATTAGATAACGGGTCTATGACAGTAGATATGAATAACCCGACA
    TGCGGTGACCGTATACGACTAACATTTGATATAGAAGACGGCATTATAAAAGATGCTAAG
    TTTGAAGGTGAAGGTTGTTCGATTTCAATGGCAAGTGCATCGATGATGACACAAGCTGTT
    AAAGGTCATTCACTTGGAGAAGCAATGCAAATGAGCCAAGAATTTACGAAAATGATGCTT
    GGTGAAGACTATGTGATTACAGAAGAAATGGGAGATATTGAAGCATTGCAAGGTGTATCT
    CAATTCCCAGCTCGTATTAAATGTGCCACATTAGCTTGGAAAGCATTGGAAAAAGGTACT
    GTTGCTAAAGAAGGTAAAGCAGAAGGTACGACTGAAGAAGAATAG
    60
    120
    180
    240
    300
    360
    420
    465

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS04705 [old locus tag: SACOL0917 ]
  • symbol: SACOL_RS04705
  • description: iron-sulfur cluster assembly scaffold protein NifU
  • length: 154
  • theoretical pI: 4.4445
  • theoretical MW: 17016.3
  • GRAVY: -0.43961

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOtherSUF system FeS assembly protein, NifU family (TIGR01994; HMM-score: 184.2)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOtherFeS cluster assembly scaffold protein NifU (TIGR03419; HMM-score: 88.2)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOtherFeS cluster assembly scaffold IscU (TIGR01999; HMM-score: 73.9)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOtherFe-S cluster assembly protein NifU (TIGR02000; HMM-score: 58.4)
    MetabolismCentral intermediary metabolismNitrogen fixationFe-S cluster assembly protein NifU (TIGR02000; HMM-score: 58.4)
    soluble methane monooxygenase-binding protein MmoD (TIGR04550; HMM-score: 13.9)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersThiaminehydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase (TIGR00097; EC 2.7.1.49,2.7.4.7; HMM-score: 13.7)
  • TheSEED:
  • PFAM:
    SufE_NifU (CL0233) NifU_N; NifU-like N terminal domain (PF01592; HMM-score: 118.2)
    Ribokinase (CL0118) Phos_pyr_kin; Phosphomethylpyrimidine kinase (PF08543; HMM-score: 16.5)
    SufE_NifU (CL0233) Lip_prot_lig_C; Bacterial lipoate protein ligase C-terminus (PF10437; HMM-score: 13.2)
    no clan definedTSCPD; TSCPD domain (PF12637; HMM-score: 12.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.138
    • Ymax_pos: 21
    • Cmax: 0.108
    • Cmax_pos: 43
    • Smax: 0.231
    • Smax_pos: 13
    • Smean: 0.164
    • D: 0.149
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446933252 NCBI
  • RefSeq: WP_001010508 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MNFNNLDQLYRSVIMDHYKNPRNKGVLDNGSMTVDMNNPTCGDRIRLTFDIEDGIIKDAKFEGEGCSISMASASMMTQAVKGHSLGEAMQMSQEFTKMMLGEDYVITEEMGDIEALQGVSQFPARIKCATLAWKALEKGTVAKEGKAEGTTEEE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS04705 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]