From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS04865 [old locus tag: SACOL0949 ]
  • pan locus tag?: SAUPAN003047000
  • symbol: SACOL_RS04865
  • pan gene symbol?: mnhG
  • synonym:
  • product: Na+/H+ antiporter subunit G

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS04865 [old locus tag: SACOL0949 ]
  • symbol: SACOL_RS04865
  • product: Na+/H+ antiporter subunit G
  • replicon: chromosome
  • strand: -
  • coordinates: 951804..952160
  • length: 357
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (951804..952160) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    ATGATCAAAATCATACTGATTAGTCTTGCACTTATCTTTGTTATCATCGGTGCTTTAATT
    AGCGCCCTAGCAGCTATAGGATTATTGAGACTTGAAGATGTATATTCACGTGCACATGCT
    GCCGGAAAAGCATCAACATTAGGTGCAATGTCATTACTATTTGGTACGTTTTTATATTTT
    ATTGCTACTCAAGGTTTTGTAAATATGCAATTAATCGTTGCGATTATCTTTGTATTAATT
    ACAGGTCCTCTTTCAAGTCATATGATTATGAAAGCAGCATATAATATTAAAACGCCTTAT
    ACTAAAAAGACTAAAGTCGATGAAATTTCGGAAGACTTAAAAGACACAAAATTGTAG
    60
    120
    180
    240
    300
    357

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS04865 [old locus tag: SACOL0949 ]
  • symbol: SACOL_RS04865
  • description: Na+/H+ antiporter subunit G
  • length: 118
  • theoretical pI: 10.0063
  • theoretical MW: 12818.4
  • GRAVY: 0.894915

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsCations and iron carrying compoundsmonovalent cation/proton antiporter, MnhG/PhaG subunit (TIGR01300; HMM-score: 87.9)
  • TheSEED:
  • PFAM:
    no clan definedPhaG_MnhG_YufB; Na+/H+ antiporter subunit (PF03334; HMM-score: 88.7)
    Phage_holin_6_1; Bacteriophage holin of superfamily 6 (Holin_LLH) (PF09682; HMM-score: 9.3)
    YtpI; YtpI-like protein (PF14007; HMM-score: 8.6)
    Sigma_reg_N; Sigma factor regulator N-terminal (PF13800; HMM-score: 7.2)
    Tetraspannin (CL0347) Tetraspannin; Tetraspanin family (PF00335; HMM-score: 6.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.251
    • Ymax_pos: 41
    • Cmax: 0.441
    • Cmax_pos: 41
    • Smax: 0.454
    • Smax_pos: 2
    • Smean: 0.216
    • D: 0.238
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit source | edit]

  • GI: 446513105 NCBI
  • RefSeq: WP_000590451 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MIKIILISLALIFVIIGALISALAAIGLLRLEDVYSRAHAAGKASTLGAMSLLFGTFLYFIATQGFVNMQLIVAIIFVLITGPLSSHMIMKAAYNIKTPYTKKTKVDEISEDLKDTKL

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS04865 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]