From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS06395 [old locus tag: SACOL1252 ]
  • pan locus tag?: SAUPAN003523000
  • symbol: SACOL_RS06395
  • pan gene symbol?:
  • synonym:
  • product: DNA-binding protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS06395 [old locus tag: SACOL1252 ]
  • symbol: SACOL_RS06395
  • product: DNA-binding protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1261341..1261673
  • length: 333
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_002951 (1261341..1261673) NCBI
  • BioCyc: G1G4B-1354 BioCyc
  • MicrobesOnline: see SACOL1252

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGGGTCAAAATGATTTAGTTAAAACGTTACGAATGAATTATTTGTTTGATTTTTATCAA
    TCCTTATTGACGAATAAACAACGTAATTATTTGGAATTATTTTATCTTGAAGATTATTCT
    TTAAGTGAAATCGCAGATACTTTTAATGTGAGTAGACAAGCAGTTTATGATAATATAAGA
    AGAACTGGCGATTTAGTTGAAGATTATGAAAAGAAATTGGAATTATACCAGAAATTTGAG
    CAACGCCGAGAAATATATGATGAAATGAAACAACATTTAAGTAATCCAGAACAAATACAA
    CGTTATATTCAACAATTAGAAGACTTAGAATAG
    60
    120
    180
    240
    300
    333

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL_RS06395 [old locus tag: SACOL1252 ]
  • symbol: SACOL_RS06395
  • description: DNA-binding protein
  • length: 110
  • theoretical pI: 4.42952
  • theoretical MW: 13581.1
  • GRAVY: -0.924545

Function[edit | edit source]

  • TIGRFAM:
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 27.6)
    and 12 more
    transcriptional regulator BotR, P-21 (TIGR03209; HMM-score: 20.3)
    RNA polymerase sigma-70 factor, Bacteroides expansion family 1 (TIGR02985; HMM-score: 18.4)
    RNA polymerase sigma-70 factor, sigma-E family (TIGR02983; HMM-score: 17.9)
    RNA polymerase sigma-70 factor, Planctomycetaceae-specific subfamily 1 (TIGR02984; HMM-score: 17.9)
    RNA polymerase sigma-W factor (TIGR02948; HMM-score: 17.6)
    RNA polymerase sigma-70 factor, Myxococcales family 1 (TIGR03001; HMM-score: 17.4)
    RNA polymerase sigma-70 factor, Rhodopirellula/Verrucomicrobium family (TIGR02989; HMM-score: 17.1)
    RNA polymerase sigma-70 factor, TIGR02954 family (TIGR02954; HMM-score: 16.7)
    RNA polymerase sigma factor, SigM family (TIGR02950; HMM-score: 15.2)
    RNA polymerase sigma factor, TIGR02999 family (TIGR02999; HMM-score: 14.3)
    Metabolism Energy metabolism Fermentation methylaspartate ammonia-lyase (TIGR01502; EC 4.3.1.2; HMM-score: 13.1)
    Metabolism Energy metabolism Amino acids and amines methylaspartate ammonia-lyase (TIGR01502; EC 4.3.1.2; HMM-score: 13.1)
  • TheSEED: see SACOL1252
  • PFAM:
    HTH (CL0123) UPF0122; Putative helix-turn-helix protein, YlxM / p13 like (PF04297; HMM-score: 142.6)
    and 22 more
    Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 29.9)
    Sigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 28.6)
    HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 24)
    HTH_11; HTH domain (PF08279; HMM-score: 21.8)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 21.7)
    Sigma70_ECF; ECF sigma factor (PF07638; HMM-score: 18.4)
    HTH_Tnp_1_2; Helix-turn-helix of insertion element transposase (PF13022; HMM-score: 17.8)
    HTH_7; Helix-turn-helix domain of resolvase (PF02796; HMM-score: 17.4)
    HTH_10; HTH DNA binding domain (PF04967; HMM-score: 15.9)
    HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 15.2)
    HTH_40; Helix-turn-helix domain (PF14493; HMM-score: 15)
    HTH_17; Helix-turn-helix domain (PF12728; HMM-score: 14.2)
    TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 14.1)
    Terminase_5; Putative ATPase subunit of terminase (gpP-like) (PF06056; HMM-score: 13.9)
    no clan defined Syntaxin-6_N; Syntaxin 6, N-terminal (PF09177; HMM-score: 13.7)
    HTH (CL0123) HTH_29; Winged helix-turn helix (PF13551; HMM-score: 13.5)
    DUF1492; Protein of unknown function (DUF1492) (PF07374; HMM-score: 13.1)
    GerE; Bacterial regulatory proteins, luxR family (PF00196; HMM-score: 12.7)
    GcrA; GcrA cell cycle regulator (PF07750; HMM-score: 12.6)
    HTH_22; HTH domain (PF13309; HMM-score: 12.6)
    TetR_N; Bacterial regulatory proteins, tetR family (PF00440; HMM-score: 11.8)
    P-loop_NTPase (CL0023) AAA_23; AAA domain (PF13476; HMM-score: 11.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.000792
    • TAT(Tat/SPI): 0.000155
    • LIPO(Sec/SPII): 0.00019
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MGQNDLVKTLRMNYLFDFYQSLLTNKQRNYLELFYLEDYSLSEIADTFNVSRQAVYDNIRRTGDLVEDYEKKLELYQKFEQRREIYDEMKQHLSNPEQIQRYIQQLEDLE

Experimental data[edit | edit source]

  • experimentally validated: see SACOL1252
  • protein localization: see SACOL1252
  • quantitative data / protein copy number per cell: see SACOL1252
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]