From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS06700 [old locus tag: SACOL1314 ]
  • pan locus tag?: SAUPAN003598000
  • symbol: SACOL_RS06700
  • pan gene symbol?:
  • synonym:
  • product: energy coupling factor transporter S component ThiW

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS06700 [old locus tag: SACOL1314 ]
  • symbol: SACOL_RS06700
  • product: energy coupling factor transporter S component ThiW
  • replicon: chromosome
  • strand: +
  • coordinates: 1329661..1330152
  • length: 492
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (1329661..1330152) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGAAATCAAGAAAACTGGCTATAACTGCACTTTTAATTGCAATAAATGTTGTATTAAGC
    AGTATTATCATCATTCCTCTAGGACCAGTTAAGGCAGCACCAGTACAGCATTTTGTAAAT
    GTATTAAGTGCGGTCATAGTAGGTCCTTGGTATGGATTAGCTCAAGCGCTTATATCATCA
    ATTTTAAGAGTTCTTTTTGGTACTGGTACAGCTTTTGCATTTCCGGGTAGTATGATTGGA
    GTTTTATTGGCTAGTATGTTTTACATATATCGTAAACATATATTTATGGCCGCGGTCGGT
    GAAGTACTTGGAACTGGTGTCATCGGAAGTTTAATTTGTATACCATTAGCATATTTCCTT
    GGGCTTCAAGACTTCTTCATTAAACCGTTAATGATTACGTTCATAGTCTCAAGTGCTATC
    GGATCTATTATAAGTTATTTCTTATTAATTACTCTAAAAAAACGTGGTATTCTTCAAAGG
    TTTATAAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    492

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS06700 [old locus tag: SACOL1314 ]
  • symbol: SACOL_RS06700
  • description: energy coupling factor transporter S component ThiW
  • length: 163
  • theoretical pI: 10.9181
  • theoretical MW: 17600.5
  • GRAVY: 1.23067

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersThiamineenergy coupling factor transporter S component ThiW (TIGR02359; HMM-score: 207)
    MetabolismTransport and binding proteinsOtherenergy coupling factor transporter S component ThiW (TIGR02359; HMM-score: 207)
    MetabolismTransport and binding proteinsUnknown substrateECF transporter S component, folate family (TIGR04518; HMM-score: 36.3)
    Cell structureCell envelopeSurface structuresPEP-CTERM protein-sorting domain (TIGR02595; HMM-score: 9)
  • TheSEED:
  • PFAM:
    Gx_transp (CL0315) ThiW; Thiamine-precursor transporter protein (ThiW) (PF09512; HMM-score: 181.3)
    ECF_trnsprt; ECF transporter, substrate-specific component (PF12822; HMM-score: 40.9)
    ECF-ribofla_trS; ECF-type riboflavin transporter, S component (PF07155; HMM-score: 26.6)
    5TM-5TMR_LYT; 5TMR of 5TMR-LYT (PF07694; HMM-score: 10.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 4
  • LocateP:
  • SignalP: Signal peptide length 33 aa
    • Ymax: 0.6
    • Ymax_pos: 33
    • Cmax: 0.746
    • Cmax_pos: 33
    • Smax: 0.692
    • Smax_pos: 1
    • Smean: 0.511
    • D: 0.565
  • predicted transmembrane helices (TMHMM): 5

Accession numbers[edit source | edit]

  • GI: 446765021 NCBI
  • RefSeq: WP_000842277 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKSRKLAITALLIAINVVLSSIIIIPLGPVKAAPVQHFVNVLSAVIVGPWYGLAQALISSILRVLFGTGTAFAFPGSMIGVLLASMFYIYRKHIFMAAVGEVLGTGVIGSLICIPLAYFLGLQDFFIKPLMITFIVSSAIGSIISYFLLITLKKRGILQRFIK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS06700 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]