From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS07835 [old locus tag: SACOL1537 ]
  • pan locus tag?: SAUPAN004027000
  • symbol: SACOL_RS07835
  • pan gene symbol?: scpB
  • synonym:
  • product: SMC-Scp complex subunit ScpB

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS07835 [old locus tag: SACOL1537 ]
  • symbol: SACOL_RS07835
  • product: SMC-Scp complex subunit ScpB
  • replicon: chromosome
  • strand: -
  • coordinates: 1575673..1576215
  • length: 543
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (1575673..1576215) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    TTGGATAATCATGGTATATTAGAGTCGCTTTTATTTACAGCTGGCGATGAAGGTTTAGAT
    GAAAAACAACTATTAGAAATATTAGATATGTCGAAAGACCAACTCGTTGAATTAATTGAA
    AATTATTCATCACATGGATTAATGATACAACGATTTGGAATGACGTATGTTTTAACGACT
    AAAAAAGAAGCGGCAACGTATATTGAACAATTAATTGAACAAAAGTCACAAATGAAATTA
    TCACAAGCAGCAATGGAAGTACTATCAATTATTGCTTATAACCAGCCATTATCAAGAAGT
    GATATTGAATTAATTCGTAGTATCAATTCAGATGGTGCAGTTAAGACATTGATTGCCAAA
    GGACTAGTTGAGGCTAAAGTGGTTAATGAACAGCGTAGCCAACAGTTAATTACTACTGAT
    TTATTTTTAAATGTATTTGGTATTTCCAATATAGAAGATTTGCCGACAACTGAAGAAGAC
    GATGAAGAAATGGATGCTTTTTTCAGTAATCTAGTCAATCAAAAAGGAGAAAATAATGAC
    TAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    543

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS07835 [old locus tag: SACOL1537 ]
  • symbol: SACOL_RS07835
  • description: SMC-Scp complex subunit ScpB
  • length: 180
  • theoretical pI: 4.03334
  • theoretical MW: 20235.7
  • GRAVY: -0.251667

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesCell divisionsegregation and condensation protein B (TIGR00281; HMM-score: 122.4)
    Genetic information processingDNA metabolismChromosome-associated proteinssegregation and condensation protein B (TIGR00281; HMM-score: 122.4)
  • TheSEED:
  • PFAM:
    HTH (CL0123) SMC_ScpB; Segregation and condensation complex subunit ScpB (PF04079; HMM-score: 138)
    no clan definedNYD-SP12_N; Spermatogenesis-associated, N-terminal (PF15015; HMM-score: 14.4)
    HTH (CL0123) HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 13.9)
    no clan definedDUF4760; Domain of unknown function (DUF4760) (PF15956; HMM-score: 13.5)
    Sigma54_AID; Sigma-54 factor, Activator interacting domain (AID) (PF00309; HMM-score: 10.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.114
    • Ymax_pos: 65
    • Cmax: 0.148
    • Cmax_pos: 65
    • Smax: 0.121
    • Smax_pos: 63
    • Smean: 0.065
    • D: 0.095
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446290798 NCBI
  • RefSeq: WP_000368653 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MDNHGILESLLFTAGDEGLDEKQLLEILDMSKDQLVELIENYSSHGLMIQRFGMTYVLTTKKEAATYIEQLIEQKSQMKLSQAAMEVLSIIAYNQPLSRSDIELIRSINSDGAVKTLIAKGLVEAKVVNEQRSQQLITTDLFLNVFGISNIEDLPTTEEDDEEMDAFFSNLVNQKGENND

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS07835 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]