From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS08095 [old locus tag: SACOL1589 ]
  • pan locus tag?: SAUPAN004108000
  • symbol: SACOL_RS08095
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS08095 [old locus tag: SACOL1589 ]
  • symbol: SACOL_RS08095
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1623331..1623912
  • length: 582
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (1623331..1623912) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGAAAAAATTGGTTTCAATTGTTGGCGCAACATTATTGTTAGCTGGATGTGGATCACAA
    AATTTAGCACCATTAGAAGAAAAAACAACAGATTTAAGAGAAGATAATCATCAACTCAAA
    CTAGATATTCAAGAACTTAATCAACAAATTAGTGATTCTAAATCTAAAATTAAAGGGCTT
    GAAAAGGATAAAGAAAACAGTAAAAAAACTGCATCTAATAATACGAAAATTAAATTGATG
    AATGTTACATCAACATACTACGACAAAGTTGCTAAAGCTTTGAAATCCTATAACGATATT
    GAGAAAGATGTAAGTAAAAACAAAGGCGATAAGAATGTTCAATCGAAATTAAATCAAATT
    TCTAATGATATTCAAAGTGCTCACACTTCATACAAAGATGCTATCGATGGTTTATCACTT
    AGTGATGATGATAAAAAAACGTCTAAAAATATCGATAAATTAAACTCTGATTTGAATCAT
    GCATTTGATGATATTAAAAATGGCTATCAAAATAAAGATAAAAAACAACTTACAAAAGGA
    CAACAAGCGTTGTCAAAATTAAACTTAAATGCAAAATCATGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    582

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS08095 [old locus tag: SACOL1589 ]
  • symbol: SACOL_RS08095
  • description: hypothetical protein
  • length: 193
  • theoretical pI: 9.8465
  • theoretical MW: 21472
  • GRAVY: -0.999482

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    SH3 domain protein (TIGR04211; HMM-score: 14.2)
    Cellular processesCellular processesPathogenesistype III secretion apparatus needle protein (TIGR02105; HMM-score: 11.3)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype III secretion apparatus needle protein (TIGR02105; HMM-score: 11.3)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype I secretion membrane fusion protein, HlyD family (TIGR01843; HMM-score: 11.2)
    Genetic information processingMobile and extrachromosomal element functionsPlasmid functionsintegrating conjugative element protein, PFL_4705 family (TIGR03752; HMM-score: 7.3)
    phage lysis regulatory protein, LysB family (TIGR03495; HMM-score: 5.8)
    MetabolismEnergy metabolismPhotosynthesisphotosystem II protein PsbQ (TIGR03042; HMM-score: 5.1)
  • TheSEED:
  • PFAM:
    OML_zippers (CL0590) LPP; Lipoprotein leucine-zipper (PF04728; HMM-score: 16.3)
    no clan definedLzipper-MIP1; Leucine-zipper of ternary complex factor MIP1 (PF14389; HMM-score: 14.8)
    IncA; IncA protein (PF04156; HMM-score: 14.2)
    Syntaxin-6_N; Syntaxin 6, N-terminal (PF09177; HMM-score: 13.9)
    DUF4763; Domain of unknown function (DUF4763) (PF15960; HMM-score: 13.4)
    LppaM (CL0421) LPAM_1; Prokaryotic membrane lipoprotein lipid attachment site (PF08139; HMM-score: 13.2)
    HTH (CL0123) Mnd1; Mnd1 family (PF03962; HMM-score: 12.5)
    no clan definedDUF5344; Family of unknown function (DUF5344) (PF17279; HMM-score: 12.3)
    TMCO5; TMCO5 family (PF14992; HMM-score: 11.8)
    YabB; Initiation control protein YabA (PF06156; HMM-score: 11.6)
    PRKG1_interact; cGMP-dependent protein kinase interacting domain (PF15898; HMM-score: 11.1)
    LppaM (CL0421) LPAM_2; Prokaryotic lipoprotein-attachment site (PF13627; HMM-score: 10.8)
    no clan definedDUF1664; Protein of unknown function (DUF1664) (PF07889; HMM-score: 10.7)
    BCLiA (CL0551) APG6; Autophagy protein Apg6 (PF04111; HMM-score: 9.8)
    Vps51 (CL0295) COG2; COG (conserved oligomeric Golgi) complex component, COG2 (PF06148; HMM-score: 9.1)
    no clan definedCnn_1N; Centrosomin N-terminal motif 1 (PF07989; HMM-score: 9.1)
    Jnk-SapK_ap_N; JNK_SAPK-associated protein-1 (PF09744; HMM-score: 8.1)
    FlaC_arch; Flagella accessory protein C (FlaC) (PF05377; HMM-score: 7.9)
    SNARE-fusion (CL0445) Syntaxin_2; Syntaxin-like protein (PF14523; HMM-score: 7.6)
    bZIP (CL0018) bZIP_1; bZIP transcription factor (PF00170; HMM-score: 7.4)
    FKBP (CL0487) Rotamase; PPIC-type PPIASE domain (PF00639; HMM-score: 7.4)
    no clan definedAx_dynein_light; Axonemal dynein light chain (PF10211; HMM-score: 7.2)
    GrpE; GrpE (PF01025; HMM-score: 6.5)
    Spc7; Spc7 kinetochore protein (PF08317; HMM-score: 5.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 3.33
    • Cellwall Score: 3.33
    • Extracellular Score: 3.33
    • Internal Helices: 0
  • LocateP:
  • SignalP: Signal peptide length 24 aa
    • Ymax: 0.337
    • Ymax_pos: 24
    • Cmax: 0.146
    • Cmax_pos: 24
    • Smax: 0.892
    • Smax_pos: 20
    • Smean: 0.757
    • D: 0.501
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446660340 NCBI
  • RefSeq: WP_000737686 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKKLVSIVGATLLLAGCGSQNLAPLEEKTTDLREDNHQLKLDIQELNQQISDSKSKIKGLEKDKENSKKTASNNTKIKLMNVTSTYYDKVAKALKSYNDIEKDVSKNKGDKNVQSKLNQISNDIQSAHTSYKDAIDGLSLSDDDKKTSKNIDKLNSDLNHAFDDIKNGYQNKDKKQLTKGQQALSKLNLNAKS

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS08095 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]