From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS08655 [old locus tag: SACOL1697 ]
  • pan locus tag?: SAUPAN004248000
  • symbol: SACOL_RS08655
  • pan gene symbol?: ruvA
  • synonym:
  • product: Holliday junction branch migration protein RuvA

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS08655 [old locus tag: SACOL1697 ]
  • symbol: SACOL_RS08655
  • product: Holliday junction branch migration protein RuvA
  • replicon: chromosome
  • strand: -
  • coordinates: 1729800..1730402
  • length: 603
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (1729800..1730402) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGTACGCGTATGTCAAAGGTAAGTTAACACATTTATATCCTACACACGTAGTTGTTGAA
    ACTGCTGGTGTTGGTTATGAAATTCAAACACCAAATTCTTATCGTTTTCAAAAGCATCTA
    GATCATGAAGTTTTAATTCATACATCTTTAATTGTTCGTGAAGATGCACAATTATTGTAT
    GGATTTAGTAGTGAAGAAGAGAAAGATATGTTCTTGAGTTTAATTAAAGTTACTGGTATT
    GGTCCGAAATCAGCTTTAGCTATTTTAGCGACAAGTACGCCTAATGAAGTAAAACGTGCC
    ATTGAAAATGAAAATGATACGTATTTAACTAAATTCCCAGGAATTGGTAAGAAAACGGCA
    AGACAGATTGTCTTAGATTTAAAAGGTAAAGTGAAAATTACTGAAGAAGATAGCGATTCA
    TTATTACAAGTAGACGCTACTTCGACGGTGCAAGATCAATTCGTGCAAGAAGCAATGTTA
    GCGTTAGAAGCATTAGGTTATTCTAAACGAGAGCTTGCAAAAGTTGAGAAAACGTTAAAT
    AAAAATAAATATGACTCAGTTGATGAAGCTGTTAAGGCAGGTCTTCAATTAGTTGTATCT
    TAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    603

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS08655 [old locus tag: SACOL1697 ]
  • symbol: SACOL_RS08655
  • description: Holliday junction branch migration protein RuvA
  • length: 200
  • theoretical pI: 6.03453
  • theoretical MW: 22262.3
  • GRAVY: -0.246

Function[edit source | edit]

  • reaction:
    EC 3.6.4.12?  ExPASy
    DNA helicaseATP + H2O = ADP + phosphate
  • TIGRFAM:
    Genetic information processingDNA metabolismDNA replication, recombination, and repairHolliday junction DNA helicase RuvA (TIGR00084; EC 3.6.4.12; HMM-score: 174)
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal protein uS13 (TIGR03631; HMM-score: 16.1)
    Unknown functionEnzymes of unknown specificityputative DNA modification/repair radical SAM protein (TIGR03916; HMM-score: 13.8)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairrecombination protein RecR (TIGR00615; HMM-score: 12.3)
  • TheSEED:
  • PFAM:
    OB (CL0021) RuvA_N; RuvA N terminal domain (PF01330; HMM-score: 73.2)
    HHH (CL0198) HHH_5; Helix-hairpin-helix domain (PF14520; HMM-score: 55)
    UBA (CL0214) RuvA_C; RuvA, C-terminal domain (PF07499; HMM-score: 39.1)
    HHH (CL0198) HHH; Helix-hairpin-helix motif (PF00633; HMM-score: 27.5)
    IMS_HHH; IMS family HHH motif (PF11798; HMM-score: 23.6)
    H2TH (CL0303) Ribosomal_S13; Ribosomal protein S13/S18 (PF00416; HMM-score: 20.6)
    HHH (CL0198) HHH_8; Helix-hairpin-helix domain (PF14716; HMM-score: 17.8)
    HHH_3; Helix-hairpin-helix motif (PF12836; HMM-score: 16.2)
    HHH_2; Helix-hairpin-helix motif (PF12826; HMM-score: 13.3)
    5_3_exonuc_C (CL0464) 5_3_exonuc; 5'-3' exonuclease, C-terminal SAM fold (PF01367; HMM-score: 13.3)
    HHH (CL0198) HHH_4; Helix-hairpin-helix containing domain (PF14490; HMM-score: 12.9)
    DNA_pol_lambd_f; Fingers domain of DNA polymerase lambda (PF10391; HMM-score: 12)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.139
    • Ymax_pos: 23
    • Cmax: 0.121
    • Cmax_pos: 36
    • Smax: 0.283
    • Smax_pos: 17
    • Smean: 0.179
    • D: 0.155
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446193692 NCBI
  • RefSeq: WP_000271547 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MYAYVKGKLTHLYPTHVVVETAGVGYEIQTPNSYRFQKHLDHEVLIHTSLIVREDAQLLYGFSSEEEKDMFLSLIKVTGIGPKSALAILATSTPNEVKRAIENENDTYLTKFPGIGKKTARQIVLDLKGKVKITEEDSDSLLQVDATSTVQDQFVQEAMLALEALGYSKRELAKVEKTLNKNKYDSVDEAVKAGLQLVVS

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS08655 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]