From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS08860 [old locus tag: SACOL1733 ]
  • pan locus tag?: SAUPAN004308000
  • symbol: SACOL_RS08860
  • pan gene symbol?: nrdR
  • synonym:
  • product: transcriptional regulator NrdR

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS08860 [old locus tag: SACOL1733 ]
  • symbol: SACOL_RS08860
  • product: transcriptional regulator NrdR
  • replicon: chromosome
  • strand: -
  • coordinates: 1764387..1764857
  • length: 471
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (1764387..1764857) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAAATGCCCGAAATGTAATTCTACACAATCTAAAGTTGTAGATTCAAGGCATGCCGAT
    GAATTAAATGCCATTCGAAGACGAAGAGAATGTGAAAATTGTGGAACACGTTTCACTACA
    TTTGAACATATCGAAGTTAGTCAGCTTATAGTTGTGAAAAAAGATGGCACAAGAGAGCAG
    TTTTCAAGAGAAAAGATACTTAATGGACTTGTGCGTTCTTGTGAGAAACGACCAGTTAGA
    TATCAACAACTTGAAGACATAACTAACAAGGTTGAATGGCAATTACGAGATGAAGGTCAT
    ACGGAAGTGTCTTCACGAGATATAGGTGAACACGTTATGAACTTGTTAATGCATGTTGAT
    CAAGTTTCATATGTTAGATTTGCATCAGTCTATAAAGAATTTAAAGATGTTGATCAATTG
    TTAGCATCGATGCAAGGGATTTTAAGCGAAAACAAACGGAGTGATGCTTAA
    60
    120
    180
    240
    300
    360
    420
    471

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS08860 [old locus tag: SACOL1733 ]
  • symbol: SACOL_RS08860
  • description: transcriptional regulator NrdR
  • length: 156
  • theoretical pI: 7.89688
  • theoretical MW: 18203.5
  • GRAVY: -0.744872

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Signal transductionRegulatory functionsDNA interactionstranscriptional regulator NrdR (TIGR00244; HMM-score: 187.7)
    Cys-rich peptide, TIGR04165 family (TIGR04165; HMM-score: 16.4)
    Signal transductionRegulatory functionsDNA interactionsputative regulatory protein, FmdB family (TIGR02605; HMM-score: 14.6)
    MJ0042 family finger-like domain (TIGR02098; HMM-score: 12)
    cxxc_20_cxxc protein (TIGR04104; HMM-score: 8.7)
  • TheSEED:
  • PFAM:
    no clan definedATP-cone; ATP cone domain (PF03477; HMM-score: 65.1)
    C2H2-zf (CL0361) zf-DBF; DBF zinc finger (PF07535; HMM-score: 19.1)
    Zn_Beta_Ribbon (CL0167) TF_Zn_Ribbon; TFIIB zinc-binding (PF08271; HMM-score: 16.3)
    Zn_Tnp_IS1595; Transposase zinc-ribbon domain (PF12760; HMM-score: 15.4)
    Zn-ribbon_8; Zinc ribbon domain (PF09723; HMM-score: 14.6)
    zinc_ribbon_5; zinc-ribbon domain (PF13719; HMM-score: 14.1)
    zf-FYVE-PHD (CL0390) FYVE; FYVE zinc finger (PF01363; HMM-score: 14)
    Zn_Beta_Ribbon (CL0167) Elf1; Transcription elongation factor Elf1 like (PF05129; HMM-score: 13.8)
    TFIIS_C; Transcription factor S-II (TFIIS) (PF01096; HMM-score: 12.2)
    C2H2-zf (CL0361) zf-C2H2; Zinc finger, C2H2 type (PF00096; HMM-score: 11.1)
    Zn_Beta_Ribbon (CL0167) zinc_ribbon_2; zinc-ribbon domain (PF13240; HMM-score: 8.7)
    zinc_ribbon_4; zinc-ribbon domain (PF13717; HMM-score: 8.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: Zn2+
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.181
    • Ymax_pos: 20
    • Cmax: 0.14
    • Cmax_pos: 20
    • Smax: 0.439
    • Smax_pos: 1
    • Smean: 0.257
    • D: 0.211
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446572736 NCBI
  • RefSeq: WP_000650082 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKCPKCNSTQSKVVDSRHADELNAIRRRRECENCGTRFTTFEHIEVSQLIVVKKDGTREQFSREKILNGLVRSCEKRPVRYQQLEDITNKVEWQLRDEGHTEVSSRDIGEHVMNLLMHVDQVSYVRFASVYKEFKDVDQLLASMQGILSENKRSDA

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS08860 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]