From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS09350 [old locus tag: SACOL1824 ]
  • pan locus tag?: SAUPAN004465000
  • symbol: SACOL_RS09350
  • pan gene symbol?: arsC
  • synonym:
  • product: protein ArsC

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS09350 [old locus tag: SACOL1824 ]
  • symbol: SACOL_RS09350
  • product: protein ArsC
  • replicon: chromosome
  • strand: +
  • coordinates: 1880090..1880485
  • length: 396
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (1880090..1880485) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    ATGACTAAAAAAACAATTTATTTTATATGTACAGGCAACTCATGTCGAAGTCAAATGGCT
    GAAGGTTGGGCTAAACAAATCTTAGCGGATGATTGGAATGTATATTCTGCTGGTATCGAA
    ACACACGGTGTTAATCCCAAAGCGATAGAAGCTATGAAAGAAGTAGGCATTGATATATCA
    AATCATACATCAGATTTAATCGATAATAATATTATTAAAAATTCAAATTTAGTTGTTACA
    TTATGTAGTGATGCAGACGTAAATTGCCCTTCTTTACCAACAAATGTTAAGAAAGAACAT
    TGGGGATTTGATGATCCTGCAGGCAAGCCTTGGTCAGAGTTCCAACGTGTAAGAGATGAA
    ATTAAAATCGCAATTGAAAATTTCAAATCACGATGA
    60
    120
    180
    240
    300
    360
    396

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS09350 [old locus tag: SACOL1824 ]
  • symbol: SACOL_RS09350
  • description: protein ArsC
  • length: 131
  • theoretical pI: 5.66473
  • theoretical MW: 14686.5
  • GRAVY: -0.444275

Function[edit source | edit]

  • reaction:
    EC 3.1.3.48?  ExPASy
    Protein-tyrosine-phosphataseProtein tyrosine phosphate + H2O = protein tyrosine + phosphate
    EC 1.20.4.-?  ExPASy
    Arsenate + thioredoxin = arsenite + thioredoxin disulfide + H2O?
  • TIGRFAM:
    Cellular processesCellular processesDetoxificationarsenate reductase (thioredoxin) (TIGR02691; EC 1.20.4.-,3.1.3.48; HMM-score: 204.4)
    Cellular processesCellular processesDetoxificationarsenate reductase, glutathione/glutaredoxin type (TIGR02689; EC 1.20.4.1; HMM-score: 104.8)
  • TheSEED:
  • PFAM:
    Phosphatase (CL0031) LMWPc; Low molecular weight phosphotyrosine protein phosphatase (PF01451; HMM-score: 86.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.231
    • Ymax_pos: 25
    • Cmax: 0.181
    • Cmax_pos: 25
    • Smax: 0.478
    • Smax_pos: 19
    • Smean: 0.297
    • D: 0.256
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446085380 NCBI
  • RefSeq: WP_000163235 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MTKKTIYFICTGNSCRSQMAEGWAKQILADDWNVYSAGIETHGVNPKAIEAMKEVGIDISNHTSDLIDNNIIKNSNLVVTLCSDADVNCPSLPTNVKKEHWGFDDPAGKPWSEFQRVRDEIKIAIENFKSR

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS09350 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]