From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS12035 [old locus tag: SACOL2289 ]
  • pan locus tag?: SAUPAN005763000
  • symbol: SACOL_RS12035
  • pan gene symbol?: sarY
  • synonym:
  • product: transcriptional regulator

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS12035 [old locus tag: SACOL2289 ]
  • symbol: SACOL_RS12035
  • product: transcriptional regulator
  • replicon: chromosome
  • strand: -
  • coordinates: 2347998..2348741
  • length: 744
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (2347998..2348741) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGTCTAAATTTAAAGTTAAGCGTTTAACTGCACACATACTAATGTTGAAAGTCATTAAT
    GATATGTTGAAATATTCATTTCATCTCACTTTGACTCAAGTGAAACTATTAAATCTATTA
    GTTAAATATGATAATTCTGATTCCAATAGCGCTTCAATAGATAGTTTATTAAAAATGAAA
    GAAATCCAATCTAAGATGGCCCTTCTTCAAATGTTAAGTTATTTAAACAATCATCAATGG
    CTATTGAAAGGAAGAGATCAAAGGGATCAACGTAAATTGACTATTTCGATTAATAAAATG
    CATATAGATAAAATAGAATATATGAATAATGAGCTTAGTGACTATATTGAACGTTATTTT
    GGTCAATATACATTTGATTTTAGTTGTGACTATGTATCGTATTTATTGTCGTCACAAGAA
    TTATTGCGGAATCTAAAGTGTTATTTAAATATGTGTCAATTATCATTAGAAGAGTTATAC
    GTTTTAGGAATATTAAATCTGCATAAAGGTCAATTGACGGTTAAAGAATTACAGGGTGAA
    TTCCATCACCCGATATTTGCGGTTAGCCCGATTTTAAAGTGTTTAATTTTGAAGGGATTA
    GTTAAAAAAGAGAGATGTGAATTAGATGAAAGGCGTGTTATTGTAACAATCAAGCGAGAA
    AAGTTTTCTAAAGTCACTATGCTTATTCAAGCATGTTATAATTATCTTGAAAAGGGAATA
    CAAGTTAATCTTAATAATAAATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    744

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS12035 [old locus tag: SACOL2289 ]
  • symbol: SACOL_RS12035
  • description: transcriptional regulator
  • length: 247
  • theoretical pI: 9.58575
  • theoretical MW: 29143.2
  • GRAVY: -0.184211

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Signal transductionRegulatory functionsDNA interactionsstaphylococcal accessory regulator family (TIGR01889; HMM-score: 198.4)
    homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 25.4)
  • TheSEED:
  • PFAM:
    HTH (CL0123) MarR_2; MarR family (PF12802; HMM-score: 24.9)
    MarR; MarR family (PF01047; HMM-score: 20.3)
    RING (CL0229) zf-C3HC4_5; Zinc finger, C3HC4 type (RING finger) (PF17121; HMM-score: 13.3)
    HTH (CL0123) TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 12.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.236
    • Ymax_pos: 11
    • Cmax: 0.124
    • Cmax_pos: 51
    • Smax: 0.648
    • Smax_pos: 1
    • Smean: 0.532
    • D: 0.351
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 445955000 NCBI
  • RefSeq: WP_000032855 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MSKFKVKRLTAHILMLKVINDMLKYSFHLTLTQVKLLNLLVKYDNSDSNSASIDSLLKMKEIQSKMALLQMLSYLNNHQWLLKGRDQRDQRKLTISINKMHIDKIEYMNNELSDYIERYFGQYTFDFSCDYVSYLLSSQELLRNLKCYLNMCQLSLEELYVLGILNLHKGQLTVKELQGEFHHPIFAVSPILKCLILKGLVKKERCELDERRVIVTIKREKFSKVTMLIQACYNYLEKGIQVNLNNK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS12035 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]