Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS12095 [old locus tag: SACOL2299 ]
- pan locus tag?: SAUPAN005784000
- symbol: SACOL_RS12095
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS12095 [old locus tag: SACOL2299 ]
- symbol: SACOL_RS12095
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2360192..2360425
- length: 234
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGTTAAAAACGTCAGCTGTAATTTCTAATACATTATTAGTCATAGGTTTAGTCTGTCTA
TTTATGATGAAATTAGTGTTAGCTATTACTTTTTTTGCTGTTTCATTATCAATTAGTCTA
GTTGTCTTTAATATGATGTTCAGAGATAGAACAACGATGAAAGTAATCGTTAACGCTTCT
TTTTTAATCGTAATATTAGCGATTGTAGTGGCATATTTTTTATTGTCTAAGTAA60
120
180
234
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL_RS12095 [old locus tag: SACOL2299 ]
- symbol: SACOL_RS12095
- description: hypothetical protein
- length: 77
- theoretical pI: 10.8508
- theoretical MW: 8548.69
- GRAVY: 1.6974
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SACOL2299
- PFAM: BPD_transp_1 (CL0404) FtsX; FtsX-like permease family (PF02687; HMM-score: 9.8)Chemosens_recp (CL0176) 7tm_6; 7tm Odorant receptor (PF02949; HMM-score: 7.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.007246
- TAT(Tat/SPI): 0.002057
- LIPO(Sec/SPII): 0.017757
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MLKTSAVISNTLLVIGLVCLFMMKLVLAITFFAVSLSISLVVFNMMFRDRTTMKVIVNASFLIVILAIVVAYFLLSK
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.