From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS12575 [old locus tag: SACOL2397 ]
  • pan locus tag?: SAUPAN005931000
  • symbol: SACOL_RS12575
  • pan gene symbol?: nasE
  • synonym:
  • product: nitrite reductase (NAD(P)H) small subunit

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS12575 [old locus tag: SACOL2397 ]
  • symbol: SACOL_RS12575
  • product: nitrite reductase (NAD(P)H) small subunit
  • replicon: chromosome
  • strand: -
  • coordinates: 2458192..2458506
  • length: 315
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (2458192..2458506) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    ATGGAAACAAAAGAAAAAATTAAAGTGACAACTATAGATGAATTAACACCCCTAATTGGA
    AAAAAGGTTATTGTCAAAGGCAAAGAGGTAGGGTTGTTTTTAACAGAAAGTGGCAAAATT
    CATGCGATTCACAATATCTGTCCACACAAACAAGGACCATTGTCTGAAGGGACAGTGAGT
    GGGGAATATGTATTTTGCCCGCTCCACGATCAAAAAATTGATTTAAATACAGGTATTGTT
    CAAGAACCTGATGAAGGTTGTGTAGATGTTTATGAGGTAGAAGTTACAGACGGGAACGTA
    TATATATGTCTGTAG
    60
    120
    180
    240
    300
    315

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS12575 [old locus tag: SACOL2397 ]
  • symbol: SACOL_RS12575
  • description: nitrite reductase (NAD(P)H) small subunit
  • length: 104
  • theoretical pI: 4.70663
  • theoretical MW: 11437.1
  • GRAVY: -0.106731

Function[edit source | edit]

  • reaction:
    EC 1.7.1.4?  ExPASy
    Nitrite reductase (NAD(P)H)Ammonia + 3 NAD(P)+ + 2 H2O = nitrite + 3 NAD(P)H
  • TIGRFAM:
    MetabolismCentral intermediary metabolismNitrogen metabolismnitrite reductase [NAD(P)H], small subunit (TIGR02378; EC 1.7.1.4; HMM-score: 82.3)
    Rieske [2Fe-2S] domain protein, MocE subfamily (TIGR02377; HMM-score: 35.7)
  • TheSEED:
  • PFAM:
    ISP-domain (CL0516) Rieske_2; Rieske-like [2Fe-2S] domain (PF13806; HMM-score: 65.1)
    Rieske; Rieske [2Fe-2S] domain (PF00355; HMM-score: 43)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.164
    • Ymax_pos: 43
    • Cmax: 0.164
    • Cmax_pos: 43
    • Smax: 0.238
    • Smax_pos: 39
    • Smean: 0.12
    • D: 0.147
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446370367 NCBI
  • RefSeq: WP_000448222 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • METKEKIKVTTIDELTPLIGKKVIVKGKEVGLFLTESGKIHAIHNICPHKQGPLSEGTVSGEYVFCPLHDQKIDLNTGIVQEPDEGCVDVYEVEVTDGNVYICL

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS12575 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]