From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS12680 [old locus tag: SACOL2416 ]
  • pan locus tag?: SAUPAN005953000
  • symbol: SACOL_RS12680
  • pan gene symbol?:
  • synonym:
  • product: cation transporter

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS12680 [old locus tag: SACOL2416 ]
  • symbol: SACOL_RS12680
  • product: cation transporter
  • replicon: chromosome
  • strand: -
  • coordinates: 2475100..2475966
  • length: 867
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (2475100..2475966) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    ATGTCTCATAATGAAAATCTTAAATTGGCGCAACGCGGTGCTTATTTGAGTTTAATTGTA
    TATATAATCTTATCTATTGTTAAGTATGTCACGGGTTTTGTCTTTAACTCTGCAGCTGTA
    AGAGCCGATGCATTAAACAATATGACAGATATTATCGTTTCTTTAGCTGTTATTATTGGA
    TTGAAAATTTCAATTAAACCTGCCGATCGAAATCATCCTTATGGCCATTTGAAGTCTGAA
    AATATTTCTTCATTATTGGTGTCATTTGTCATTATGTTTGTAGGTATCCAAGTAGTTATT
    CAAAATGCACCTCGTTTGTTCAAAGAAGATGACGTTGTACCTAACGCAATAACAATTATC
    GTCAGCTTAATCAGTGGTCTTGTAATGTTGATTGTATTTGCAGTCAATCAAAGACTAGCG
    AAAAGAACGAAAAGTAGTTCTTTAAATTCGGCTGCCAAAGATAATTTATCGGATAGTTTA
    GTCAGCATTGGAACAGCGATAGGATTAATTTTTACGCAAATCGGTTTCCCAATTGTCGAT
    ATTATTTTAGCAACATTACTAGGCTTACTAATCGTTTATACTGGTTTTGGTATTTTTAAA
    GAAGCAATTTTTATGTTGAGTGATGGTTTCAATGAAACTGAATTAGAAGCGTATCGCAAT
    GATATTTTAGAAGTTGATGAAGTACAAGAAGTTAAAAGTATTAAAGGGCGTTACCATGGA
    AGTAGTGTGTTTATTGATGTCACAATTGTTGTAGATGCTAACCTTTCCTTAGTAGAAGCG
    CATCAAATTTGTGACAATGTCGAACATCATTTGCACAAAAAAGGTATTTCCTCAGTATAC
    GTTCACCCAGAACCAGACCATCTATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    867

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS12680 [old locus tag: SACOL2416 ]
  • symbol: SACOL_RS12680
  • description: cation transporter
  • length: 288
  • theoretical pI: 6.34453
  • theoretical MW: 31581.6
  • GRAVY: 0.489583

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsCations and iron carrying compoundscation diffusion facilitator family transporter (TIGR01297; HMM-score: 210.8)
  • TheSEED:
  • PFAM:
    no clan definedCation_efflux; Cation efflux family (PF01545; HMM-score: 155.3)
    ZT_dimer; Dimerisation domain of Zinc Transporter (PF16916; HMM-score: 65.9)
    EI24; Etoposide-induced protein 2.4 (EI24) (PF07264; HMM-score: 14.6)
    LapA_dom; Lipopolysaccharide assembly protein A domain (PF06305; HMM-score: 9.7)
    Transporter (CL0375) Claudin_2; PMP-22/EMP/MP20/Claudin tight junction (PF13903; HMM-score: 9.5)
    no clan definedDUF4396; Domain of unknown function (DUF4396) (PF14342; HMM-score: 7.7)
    IT (CL0182) CitMHS; Citrate transporter (PF03600; HMM-score: 7.2)
    no clan definedDUF5467; Family of unknown function (DUF5467) (PF17555; HMM-score: 6.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 6
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.21
    • Ymax_pos: 45
    • Cmax: 0.16
    • Cmax_pos: 45
    • Smax: 0.412
    • Smax_pos: 36
    • Smean: 0.174
    • D: 0.196
  • predicted transmembrane helices (TMHMM): 5

Accession numbers[edit source | edit]

  • GI: 445941272 NCBI
  • RefSeq: WP_000019127 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MSHNENLKLAQRGAYLSLIVYIILSIVKYVTGFVFNSAAVRADALNNMTDIIVSLAVIIGLKISIKPADRNHPYGHLKSENISSLLVSFVIMFVGIQVVIQNAPRLFKEDDVVPNAITIIVSLISGLVMLIVFAVNQRLAKRTKSSSLNSAAKDNLSDSLVSIGTAIGLIFTQIGFPIVDIILATLLGLLIVYTGFGIFKEAIFMLSDGFNETELEAYRNDILEVDEVQEVKSIKGRYHGSSVFIDVTIVVDANLSLVEAHQICDNVEHHLHKKGISSVYVHPEPDHL

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS12680 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]