From AureoWiki
Jump to: navigation, search
04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS13005
  • pan locus tag?:
  • symbol: SACOL_RS13005
  • pan gene symbol?:
  • synonym:
  • product: short-chain dehydrogenase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS13005
  • symbol: SACOL_RS13005
  • product: short-chain dehydrogenase
  • replicon: chromosome
  • strand: -
  • coordinates: 2538248..2538967
  • length: 720
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (2538248..2538967) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    TTGGCGGTAGACATAGCTGAAGCGGTATCGGAGACTGTCGATAAAATTAAAAGTAATGGT
    GACAATGCGAAGGCGTATAATGTGGATAATGCAAGCGAACAACAAGTGGTAGACTTTGTG
    TCTGACATAAAGGAACAGTTTGGAAGAATCGATGTGTTGTTTAATAATGCCGGTGTGGAT
    AATGCGGCTGATAGAATTCATGAGTATCCAATAGATGTGTATGACAAGATTATGAATGTA
    GATATGCGTGGGACATTTTTAATGACGAAAATGATGTTACCTTTAATGATGAATCAAGGT
    GGCTCTATTGTTAATACGTCTTCATTTTCCGGACAAGCAGCAGACTTGTATCGCTCTGGA
    TATAATGCTGCGAAAGGTGCAGTGATTAATTTTACAAAATCAATCGCAATTGAGTATGGC
    CGTGATAGCATTCGAGCCAATGCGATTGCACCAGGTACAATTGAAACCCCGTTAGTAGAT
    AAACTGACAGGTACGAGTGAGGATGATGCAGGTAAAACATTTAGAGAAAATCAAAAATGG
    ATGACTCCGCTGGGACGTTTAGGTAAACCAGAAGAAGTTGCTAAATTAGTAGTCTTCTTA
    GCATCTGACGACAGTTCATTCATAACTGGAGAGACGATTCGAATTGATGGTGGTGTGATG
    GCTTACACATGGCCTGGCGAGATGTTAAGTGATGATTCGTGGAAGCGGACATTGGAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS13005
  • symbol: SACOL_RS13005
  • description: short-chain dehydrogenase
  • length: 239
  • theoretical pI: 4.3468
  • theoretical MW: 26189.3
  • GRAVY: -0.277406

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismFatty acid and phospholipid metabolismBiosynthesis3-oxoacyl-[acyl-carrier-protein] reductase (TIGR01830; EC 1.1.1.100; HMM-score: 166.6)
    Unknown functionEnzymes of unknown specificitySDR family mycofactocin-dependent oxidoreductase (TIGR03971; EC 1.1.99.-; HMM-score: 155.3)
    3-hydroxybutyrate dehydrogenase (TIGR01963; HMM-score: 150.5)
    MetabolismEnergy metabolismFermentationacetoin reductases (TIGR02415; EC 1.1.1.-; HMM-score: 134.9)
    2-hydroxycyclohexanecarboxyl-CoA dehydrogenase (TIGR03206; EC 1.1.1.-; HMM-score: 134.8)
    acetoacetyl-CoA reductase (TIGR01829; EC 1.1.1.36; HMM-score: 133.8)
    2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase (TIGR04316; EC 1.3.1.28; HMM-score: 127)
    MetabolismEnergy metabolismBiosynthesis and degradation of polysaccharides2-deoxy-D-gluconate 3-dehydrogenase (TIGR01832; EC 1.1.1.125; HMM-score: 126.4)
    Unknown functionEnzymes of unknown specificitySDR family mycofactocin-dependent oxidoreductase (TIGR04504; EC 1.1.99.-; HMM-score: 98.4)
    MetabolismFatty acid and phospholipid metabolismBiosynthesisputative 3-oxoacyl-(acyl-carrier-protein) reductase (TIGR01831; HMM-score: 92.6)
    rhamnulose-1-phosphate aldolase/alcohol dehydrogenase (TIGR02632; EC 1.1.1.1,4.1.2.19; HMM-score: 77.8)
    cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase (TIGR03325; EC 1.3.1.56; HMM-score: 67)
    pteridine reductase (TIGR02685; EC 1.5.1.33; HMM-score: 53.4)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersChlorophyll and bacteriochlorphylllight-dependent protochlorophyllide reductase (TIGR01289; EC 1.3.1.33; HMM-score: 13.3)
  • TheSEED:
  • PFAM:
    NADP_Rossmann (CL0063) adh_short_C2; Enoyl-(Acyl carrier protein) reductase (PF13561; HMM-score: 202.7)
    adh_short; short chain dehydrogenase (PF00106; HMM-score: 135.5)
    KR; KR domain (PF08659; HMM-score: 24.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.191
    • Ymax_pos: 26
    • Cmax: 0.356
    • Cmax_pos: 26
    • Smax: 0.137
    • Smax_pos: 18
    • Smean: 0.095
    • D: 0.153
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI:
  • RefSeq: WP_000257478 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MAVDIAEAVSETVDKIKSNGDNAKAYNVDNASEQQVVDFVSDIKEQFGRIDVLFNNAGVDNAADRIHEYPIDVYDKIMNVDMRGTFLMTKMMLPLMMNQGGSIVNTSSFSGQAADLYRSGYNAAKGAVINFTKSIAIEYGRDSIRANAIAPGTIETPLVDKLTGTSEDDAGKTFRENQKWMTPLGRLGKPEEVAKLVVFLASDDSSFITGETIRIDGGVMAYTWPGEMLSDDSWKRTLE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS13005 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]