From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS13465 [old locus tag: SACOL2570 ]
  • pan locus tag?: SAUPAN006218000
  • symbol: SACOL_RS13465
  • pan gene symbol?:
  • synonym:
  • product: maltose O-acetyltransferase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS13465 [old locus tag: SACOL2570 ]
  • symbol: SACOL_RS13465
  • product: maltose O-acetyltransferase
  • replicon: chromosome
  • strand: -
  • coordinates: 2631968..2632567
  • length: 600
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (2631968..2632567) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGACTGAAAAAGAAAAAATGTTAGCAGAAAAATGGTACGATGCAAACTTTGATCAATAC
    TTAATCAATGAACGTGCACGAGCGAAAGATATTTGCTTTGAATTAAATCATACAAGACCG
    AGTGCTACAAATAAAAGAAAGGAATTAATTGATCAATTATTTCAAACAACAACAGACAAT
    GTAAGTATTTCGATTCCTTTTGATACAGATTATGGTTGGAACGTTAAACTAGGAAAAAAT
    GTCTATGTAAACACCAATTGTTACTTTATGGATGGTGGACAGATTACAATTGGCGATAAT
    GTTTTTATAGGACCTAATTGTGGATTCTACACAGCGACACATCCACTTAATTTCCATCAT
    AGAAATGAAGGTTTTGAAAAAGCCGGACCCATTCATATTGGCAGTAATACTTGGTTTGGC
    GGTCATGTAGCCGTGTTACCAGGGGTGACGATTGGAGAAGGCAGTGTGATTGGTGCTGGT
    AGTGTTGTCACTAAAGATATTCCGCCACACAGCTTAGCGGTTGGAAACCCTTGTAAAGTC
    GTTCGTAAAATTGATAATGACCTACCATCCGAAACATTAAATGACGAAACGATAAAGTAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600

Protein[edit source | edit]

Protein Data Bank: 3FTT
Protein Data Bank: 3V4E
Protein Data Bank: 4DCL
Protein Data Bank: 4EGG

General[edit source | edit]

  • locus tag: SACOL_RS13465 [old locus tag: SACOL2570 ]
  • symbol: SACOL_RS13465
  • description: maltose O-acetyltransferase
  • length: 199
  • theoretical pI: 6.14716
  • theoretical MW: 22118.7
  • GRAVY: -0.397487

Function[edit source | edit]

  • reaction:
    EC 2.3.1.18?  ExPASy
    Galactoside O-acetyltransferaseAcetyl-CoA + a beta-D-galactoside = CoA + a 6-acetyl-beta-D-galactoside
  • TIGRFAM:
    colanic acid biosynthesis acetyltransferase WcaF (TIGR04008; EC 2.3.1.-; HMM-score: 70.4)
    sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family (TIGR03570; HMM-score: 65.9)
    phosphonate metabolim protein, transferase hexapeptide repeat family (TIGR03308; HMM-score: 54.5)
    2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase (TIGR03532; EC 2.3.1.89; HMM-score: 51.6)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesUDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR01173; EC 2.3.1.157,2.7.7.23; HMM-score: 44.5)
    Cell structureCell envelopeBiosynthesis and degradation of murein sacculus and peptidoglycanUDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR01173; EC 2.3.1.157,2.7.7.23; HMM-score: 44.5)
    MetabolismCentral intermediary metabolismAmino sugarsUDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR01173; EC 2.3.1.157,2.7.7.23; HMM-score: 44.5)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesUDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase LpxD (TIGR01853; EC 2.3.1.191; HMM-score: 42.7)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesacyl-[acyl-carrier-protein]-UDP-N-acetylglucosamine O-acyltransferase (TIGR01852; EC 2.3.1.129; HMM-score: 36.6)
    MetabolismAmino acid biosynthesisSerine familyserine O-acetyltransferase (TIGR01172; EC 2.3.1.30; HMM-score: 33.3)
    colanic acid biosynthesis acetyltransferase WcaB (TIGR04016; EC 2.3.1.-; HMM-score: 32.7)
    non-ribosomal peptide synthetase terminal domain of unknown function (TIGR02353; HMM-score: 30.3)
    MetabolismEnergy metabolismOtherphenylacetic acid degradation protein PaaY (TIGR02287; HMM-score: 26.7)
    UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR03992; EC 2.3.1.157,2.7.7.23; HMM-score: 15.3)
    MetabolismAmino acid biosynthesisAspartate family2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (TIGR00965; EC 2.3.1.117; HMM-score: 11.5)
  • TheSEED:
  • PFAM:
    no clan definedMac; Maltose acetyltransferase (PF12464; HMM-score: 56.3)
    HEXAPEP (CL0536) Hexapep_2; Hexapeptide repeat of succinyl-transferase (PF14602; HMM-score: 53.7)
    Hexapep; Bacterial transferase hexapeptide (six repeats) (PF00132; HMM-score: 50.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.1
    • Ymax_pos: 43
    • Cmax: 0.129
    • Cmax_pos: 29
    • Smax: 0.105
    • Smax_pos: 46
    • Smean: 0.067
    • D: 0.087
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446058645 NCBI
  • RefSeq: WP_000136500 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MTEKEKMLAEKWYDANFDQYLINERARAKDICFELNHTRPSATNKRKELIDQLFQTTTDNVSISIPFDTDYGWNVKLGKNVYVNTNCYFMDGGQITIGDNVFIGPNCGFYTATHPLNFHHRNEGFEKAGPIHIGSNTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPPHSLAVGNPCKVVRKIDNDLPSETLNDETIK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS13465 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]