From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS14060 [old locus tag: SACOL2686 ]
  • pan locus tag?: SAUPAN006408000
  • symbol: SACOL_RS14060
  • pan gene symbol?: cap1B
  • synonym:
  • product: capsular polysaccharide biosynthesis protein Cap5B

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS14060 [old locus tag: SACOL2686 ]
  • symbol: SACOL_RS14060
  • product: capsular polysaccharide biosynthesis protein Cap5B
  • replicon: chromosome
  • strand: -
  • coordinates: 2760376..2761068
  • length: 693
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (2760376..2761068) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGACGAATACACGAAGAAGTACATCAAGTTTAATTGTCCATGAACAACCAAAGTCACCT
    ATTAGCGAGAAATTTCGAGGCATAAGATCAAATATTATGTTTGCAAATCCTGACAGTGCA
    GTTCAAAGCATTGTAATCACTTCAGAGGCACCAGGCGCAGGTAAGTCTACAATTGCAGCA
    AATTTAGCAGTTGCATATGCGCAAGCAGGTTATAAAACACTAATCGTAGACGGGGATATG
    CGTAAACCTACGCAGCATTATATTTTTAATTTGCCAAACAATGAAGGCCTATCAAGTTTA
    TTGCTAAATTGGTCAACTTATCAAGACAGTATTATCTCAACTGAAATTCAAGATTTAGAC
    GTCTTGACGTCTGGGCCAATCCCACCGAATCCGTCAGAGTTAATTACATCAAGGGCATTT
    GCAAATTTGTATGACACATTATTGATGAATTATAACTTTGTAATTATCGATACGCCACCA
    GTGAACACAGTTACAGATGCGCAATTATTTTCAAAGTTTACCGGCAATGTTGTCTACGTA
    GTTAATTCGGAAAATAATAATAGAGATGAAGTTAAAAAAGGAAAAGAACTTATTGAAGCA
    ACAGGTGCTAAATTATTAGGTGTAGTCTTAAATAGAATGCCTAAAGATAAAAGTGCTAGT
    TACTATGCATATTATGGGACTGATGAATCATGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    693

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS14060 [old locus tag: SACOL2686 ]
  • symbol: SACOL_RS14060
  • description: capsular polysaccharide biosynthesis protein Cap5B
  • length: 230
  • theoretical pI: 5.30455
  • theoretical MW: 25251.3
  • GRAVY: -0.247391

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidscapsular exopolysaccharide family (TIGR01007; HMM-score: 258.7)
    chain length determinant protein tyrosine kinase EpsG (TIGR03029; HMM-score: 145.5)
    exopolysaccharide/PEP-CTERM locus tyrosine autokinase (TIGR03018; EC 2.7.10.2; HMM-score: 129.1)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsexopolysaccharide transport protein family (TIGR01005; HMM-score: 113.1)
    cell division ATPase MinD (TIGR01969; HMM-score: 55.5)
    Cellular processesCellular processesCell divisionseptum site-determining protein MinD (TIGR01968; HMM-score: 40.2)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidescellulose synthase operon protein YhjQ (TIGR03371; HMM-score: 37.4)
    helicase/secretion neighborhood CpaE-like protein (TIGR03815; HMM-score: 25.7)
    MetabolismCentral intermediary metabolismNitrogen fixationnitrogenase iron protein (TIGR01287; EC 1.18.6.1; HMM-score: 17.4)
    Genetic information processingMobile and extrachromosomal element functionsPlasmid functionsplasmid partitioning protein RepA (TIGR03453; HMM-score: 17.4)
    Hypothetical proteinsConservedtransport-energizing ATPase, TRC40/GET3/ArsA family (TIGR00345; EC 3.6.1.-; HMM-score: 16.7)
    arsenical pump-driving ATPase (TIGR04291; EC 3.6.1.-; HMM-score: 16.3)
    MetabolismCentral intermediary metabolismSulfur metabolismadenylyl-sulfate kinase (TIGR00455; EC 2.7.1.25; HMM-score: 16.2)
    putative cytidylate kinase (TIGR02173; EC 2.7.4.14; HMM-score: 14.1)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersChlorophyll and bacteriochlorphylllight-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein (TIGR01281; EC 1.3.7.7; HMM-score: 13.8)
    signal recognition particle protein SRP54 (TIGR01425; HMM-score: 12.8)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingsignal recognition particle-docking protein FtsY (TIGR00064; HMM-score: 11.7)
    HprK-related kinase A (TIGR04352; HMM-score: 10.9)
  • TheSEED:
  • PFAM:
    P-loop_NTPase (CL0023) CbiA; CobQ/CobB/MinD/ParA nucleotide binding domain (PF01656; HMM-score: 51.7)
    ParA; NUBPL iron-transfer P-loop NTPase (PF10609; HMM-score: 46.5)
    AAA_31; AAA domain (PF13614; HMM-score: 45.8)
    MipZ; ATPase MipZ (PF09140; HMM-score: 35.6)
    CBP_BcsQ; Cellulose biosynthesis protein BcsQ (PF06564; HMM-score: 27.7)
    ArsA_ATPase; Anion-transporting ATPase (PF02374; HMM-score: 20.1)
    AAA_26; AAA domain (PF13500; HMM-score: 20)
    AAA_25; AAA domain (PF13481; HMM-score: 16.9)
    APS_kinase; Adenylylsulphate kinase (PF01583; HMM-score: 16.4)
    CLP1_P; mRNA cleavage and polyadenylation factor CLP1 P-loop (PF16575; HMM-score: 15.9)
    SRP54; SRP54-type protein, GTPase domain (PF00448; HMM-score: 14.8)
    Fer4_NifH; 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family (PF00142; HMM-score: 14.6)
    KTI12; Chromatin associated protein KTI12 (PF08433; HMM-score: 12.3)
    AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 12.2)
    ArgK; ArgK protein (PF03308; HMM-score: 12)
    AAA_30; AAA domain (PF13604; HMM-score: 12)
    AAA_24; AAA domain (PF13479; HMM-score: 12)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.01
    • Cytoplasmic Membrane Score: 9.99
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.191
    • Ymax_pos: 11
    • Cmax: 0.153
    • Cmax_pos: 60
    • Smax: 0.486
    • Smax_pos: 1
    • Smean: 0.341
    • D: 0.249
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446108009 NCBI
  • RefSeq: WP_000185864 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSIVITSEAPGAGKSTIAANLAVAYAQAGYKTLIVDGDMRKPTQHYIFNLPNNEGLSSLLLNWSTYQDSIISTEIQDLDVLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPPVNTVTDAQLFSKFTGNVVYVVNSENNNRDEVKKGKELIEATGAKLLGVVLNRMPKDKSASYYAYYGTDES

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS14060 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]