From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS14140 [old locus tag: SACOL2703 ]
  • pan locus tag?: SAUPAN006434000
  • symbol: SACOL_RS14140
  • pan gene symbol?: hisG
  • synonym:
  • product: ATP phosphoribosyltransferase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS14140 [old locus tag: SACOL2703 ]
  • symbol: SACOL_RS14140
  • product: ATP phosphoribosyltransferase
  • replicon: chromosome
  • strand: -
  • coordinates: 2775735..2776349
  • length: 615
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (2775735..2776349) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGTTAAGAATCGCCATAGCCAAAGGACGTCTAATGGATAGTTTAATTAACTATTTAGAT
    GTAATTGAATATACGACATTATCAGAAACATTAAAAAATAGAGAACGCCAATTATTATTA
    AGTGTAGATAATATTGAATGCATTTTAGTAAAAGGAAGTGACGTGCCAATCTATGTGGAA
    CAAGGAATGGCAGACATAGGCATTGTTGGTAGCGACATATTAGATGAGCGCCAATATAAT
    GTTAATAATTTGTTGAATATGCCTTTTGGAGCATGTCATTTTGCGGTTGCAGCGAAACCT
    GAAACGACCAATTATCGTAAAATCGCAACGAGTTATGTTCATACTGCTGAAACATATTTT
    AAATCAAAAGGTATTGATGTCGAATTGATTAAATTGAATGGCTCTGTTGAATTGGCCTGT
    GTTGTAGATATGGTAGACGGAATTGTCGACATCGTTCAAACAGGTACTACGCTAAAAGCG
    AACGGACTGGTTGAAAAGCAACATATTAGTGATATCAATGCAAGATTAATAACTAATAAA
    GCAGCTTATTTTAAAAAATCACAATTAATAGAGCAATTTATTCGCTCTTTGGAGGTGTCT
    ATTGCCAATGCTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    615

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS14140 [old locus tag: SACOL2703 ]
  • symbol: SACOL_RS14140
  • description: ATP phosphoribosyltransferase
  • length: 204
  • theoretical pI: 5.32275
  • theoretical MW: 22643
  • GRAVY: 0.0897059

Function[edit source | edit]

  • reaction:
    EC 2.4.2.17?  ExPASy
    ATP phosphoribosyltransferase1-(5-phospho-beta-D-ribosyl)-ATP + diphosphate = ATP + 5-phospho-alpha-D-ribose 1-diphosphate
  • TIGRFAM:
    MetabolismAmino acid biosynthesisHistidine familyATP phosphoribosyltransferase (TIGR00070; EC 2.4.2.17; HMM-score: 181.6)
  • TheSEED:
  • PFAM:
    PBP (CL0177) HisG; ATP phosphoribosyltransferase (PF01634; HMM-score: 158.7)
    NMT1; NMT1/THI5 like (PF09084; HMM-score: 15.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.131
    • Ymax_pos: 11
    • Cmax: 0.111
    • Cmax_pos: 65
    • Smax: 0.285
    • Smax_pos: 1
    • Smean: 0.14
    • D: 0.135
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446866893 NCBI
  • RefSeq: WP_000944149 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MLRIAIAKGRLMDSLINYLDVIEYTTLSETLKNRERQLLLSVDNIECILVKGSDVPIYVEQGMADIGIVGSDILDERQYNVNNLLNMPFGACHFAVAAKPETTNYRKIATSYVHTAETYFKSKGIDVELIKLNGSVELACVVDMVDGIVDIVQTGTTLKANGLVEKQHISDINARLITNKAAYFKKSQLIEQFIRSLEVSIANA

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS14140 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]