From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS14280 [old locus tag: SACOL2732 ]
  • pan locus tag?: SAUPAN006480000
  • symbol: SACOL_RS14280
  • pan gene symbol?:
  • synonym:
  • product: transcriptional regulator

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS14280 [old locus tag: SACOL2732 ]
  • symbol: SACOL_RS14280
  • product: transcriptional regulator
  • replicon: chromosome
  • strand: -
  • coordinates: 2801462..2802031
  • length: 570
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (2801462..2802031) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    TTGAATCTGAGTAAACAAATTAAAAAGTATAGGGAACGAGATGGTTATTCACAAGAATAT
    CTTGCTGAAAAGTTATATGTATCTAGGCAGAGTATTTCTAATTGGGAAAATGACAAAAGC
    TTACCAGACATACATAACTTATTAATGATGTGTGAATTGTTCAATGTAACTTTAGATGAT
    TTAGTAAAAGGGACCATTCCATTTGTACCTGATATTAAAGCGCAACGAAGTCTTAACTTA
    TGGACATATGTGATGCTTATTTTCATGACATTAGCTGCAATTTTAATGGGACCTTTAGTT
    GTTTATTGGAATTGGACTTGGGGTGTAACGGTGGCAATCATTTTGGGAATAGGTTTTTAT
    GCATCTATGAAAATAGAAGATTTAAAAAAAGTGCATAAAATGGACAACTACGATCGAATT
    GTTGCTTTTATGAATGGAAAAGATCCTAGTGAAGTACAAACGACTAAAGCTAGAAATACG
    ATGACAAATGCGCTTTCTATTATATCAGTAATTGGTATACTCAGCCTCATAATTTTCCTT
    AGTGTGTATTTGGCAAATAAGTTTTTATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    570

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS14280 [old locus tag: SACOL2732 ]
  • symbol: SACOL_RS14280
  • description: transcriptional regulator
  • length: 189
  • theoretical pI: 9.20529
  • theoretical MW: 21756.5
  • GRAVY: 0.18254

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Signal transductionRegulatory functionsDNA interactionstranscriptional regulator, y4mF family (TIGR03070; HMM-score: 36.8)
    putative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 20.7)
    Hypothetical proteinsConservedTIGR00270 family protein (TIGR00270; HMM-score: 20.6)
    integral membrane protein (TIGR04561; HMM-score: 7.8)
  • TheSEED:
  • PFAM:
    HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 61.5)
    HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 41.8)
    HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 31.2)
    HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 23.3)
    YdaS_antitoxin; Putative antitoxin of bacterial toxin-antitoxin system, YdaS/YdaT (PF15943; HMM-score: 16.7)
    IT (CL0182) DctM; Tripartite ATP-independent periplasmic transporter, DctM component (PF06808; HMM-score: 16.6)
    HTH (CL0123) Phage_CI_repr; Bacteriophage CI repressor helix-turn-helix domain (PF07022; HMM-score: 16.3)
    HTH_11; HTH domain (PF08279; HMM-score: 12.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.118
    • Ymax_pos: 11
    • Cmax: 0.105
    • Cmax_pos: 41
    • Smax: 0.198
    • Smax_pos: 1
    • Smean: 0.126
    • D: 0.121
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit source | edit]

  • GI: 446976862 NCBI
  • RefSeq: WP_001054118 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MNLSKQIKKYRERDGYSQEYLAEKLYVSRQSISNWENDKSLPDIHNLLMMCELFNVTLDDLVKGTIPFVPDIKAQRSLNLWTYVMLIFMTLAAILMGPLVVYWNWTWGVTVAIILGIGFYASMKIEDLKKVHKMDNYDRIVAFMNGKDPSEVQTTKARNTMTNALSIISVIGILSLIIFLSVYLANKFL

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS14280 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]